Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56520 50 / 1e-09 unknown protein AT1G55365 45 / 2e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020285 [exp] 144 / 6e-47 AT5G56520 46 / 3e-08 unknown protein Lus10013409 [exp] 57 / 8e-12 AT1G55365 87 / 9e-23 unknown protein Lus10010316 [exp] 45 / 3e-07 AT1G55365 85 / 5e-22 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G057832 [exp] 109 / 3e-33 ND / Potri.013G057766 [exp] 103 / 1e-30 ND / Potri.001G003500 [exp] 59 / 9e-13 AT5G56520 72 / 1e-17 unknown protein Potri.003G221500 [exp] 54 / 5e-11 AT5G56520 79 / 2e-20 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005700 pacid=23168867 polypeptide=Lus10005700 locus=Lus10005700.g ID=Lus10005700.BGIv1.0 annot-version=v1.0 ATGGTACTGAACACGAATCTGGCGGTGACGGTGGCCGGAGTATCAGCAAGCTTATGCCAGTACATCGCCTGCAACCCAGAACGCCTCCCGAGCGACCAAG TCCTCCACCTAATCTTCTGCCTCCCTGCCCAGCAACTCGGCCGCGTCGCCATCTCCCTCTGGACGTATCTCTGCTACAACCCTAACCCGGCCAATTACGT CACCGATCTCGACTCCTCCGACTCCGATTAA
AA sequence Show only first row Show all	>Lus10005700 pacid=23168867 polypeptide=Lus10005700 locus=Lus10005700.g ID=Lus10005700.BGIv1.0 annot-version=v1.0 MVLNTNLAVTVAGVSASLCQYIACNPERLPSDQVLHLIFCLPAQQLGRVAISLWTYLCYNPNPANYVTDLDSSDSD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G56520			unknown protein		Lus10005700 [exp]	0	1
AT1G64520		RPN12A	regulatory particle non-ATPase...		Lus10001813 [exp]	1.4	0.8522
					Lus10011965 [exp]	1.7	0.8630
AT1G48170			unknown protein		Lus10011844 [exp]	3.9	0.8376
AT4G27950	AP2_ERF	CRF4	cytokinin response factor 4 (....		Lus10010129 [exp]	8.5	0.8252
AT5G19090			Heavy metal transport/detoxifi...		Lus10031514 [exp]	8.8	0.8058
AT5G44280		ATRING1A	ARABIDOPSIS THALIANA RING 1A, ...		Lus10018609 [exp]	20.1	0.8052
AT3G51060		SRS1, STY1	STYLISH 1, SHI RELATED SEQUENC...		Lus10041803 [exp]	21.4	0.7941
AT5G65520			Tetratricopeptide repeat (TPR)...		Lus10025714 [exp]	22.2	0.7797
AT1G17130			Family of unknown function (DU...		Lus10013707 [exp]	25.7	0.8097
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Lus10011984 [exp]	27.9	0.8160

Compare expression of checked genes

Lus10005700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.