Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005713 pacid=23175368 polypeptide=Lus10005713 locus=Lus10005713.g ID=Lus10005713.BGIv1.0 annot-version=v1.0 ATGGCAGATTGGGGATGGCATCTGGGTTGGCCCGCGATGGGTAATCATGGACTCTACCCGAAATGTGGGCTTTTTGGCCCGGATTTTGGACCCGGAGATG GTTCGCGGGTAGCCCGAAAACCGGCGAACACGGGTATCGGGTGGGGATGGTTTTCGCCGAATCCGGCCCGCGGCCCATCCGTTGGTTAA
AA sequence Show only first row Show all	>Lus10005713 pacid=23175368 polypeptide=Lus10005713 locus=Lus10005713.g ID=Lus10005713.BGIv1.0 annot-version=v1.0 MADWGWHLGWPAMGNHGLYPKCGLFGPDFGPGDGSRVARKPANTGIGWGWFSPNPARGPSVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10005713 [exp]	0	1
AT3G27670		RST1	RESURRECTION1, ARM repeat supe...		Lus10010375 [exp]	7.8	0.9051
AT5G15680			ARM repeat superfamily protein...		Lus10035142 [exp]	18.4	0.8951
AT4G31400		CTF7	damaged DNA binding;DNA-direct...		Lus10016954 [exp]	18.9	0.8248
AT1G17450			B-block binding subunit of TFI...		Lus10000374 [exp]	20.3	0.8923
					Lus10008200 [exp]	21.8	0.8907
AT1G79540			Pentatricopeptide repeat (PPR)...		Lus10020852 [exp]	29.2	0.8784
AT3G12810		CHR13, SRCAP, P...	PHOTOPERIOD-INDEPENDENT EARLY ...		Lus10007174 [exp]	31.8	0.8862
ATMG01360		ATMG01360.1, CO...	cytochrome oxidase (.1)		Lus10009204 [exp]	33.1	0.8793
AT4G29380		AtVPS15	Arabidopsis thaliana vacuolar ...		Lus10011135 [exp]	38.8	0.8770
AT3G01460		MBD9, ATMBD9	methyl-CPG-binding domain 9 (....		Lus10008796 [exp]	39.5	0.8810

Compare expression of checked genes

Lus10005713 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.