Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G60030 87 / 7e-22 ATNAT7 ARABIDOPSIS NUCLEOBASE-ASCORBATE TRANSPORTER 7, nucleobase-ascorbate transporter 7 (.1) AT5G62890 82 / 2e-20 Xanthine/uracil permease family protein (.1.2.3.4) AT5G49990 82 / 3e-20 Xanthine/uracil permease family protein (.1) AT1G10540 76 / 7e-18 ATNAT8 nucleobase-ascorbate transporter 8 (.1) AT5G25420 56 / 6e-11 Xanthine/uracil/vitamin C permease (.1) AT1G65550 55 / 1e-10 Xanthine/uracil permease family protein (.1) AT2G34190 54 / 4e-10 Xanthine/uracil permease family protein (.1) AT1G49960 49 / 3e-08 Xanthine/uracil permease family protein (.1) AT2G05760 48 / 5e-08 Xanthine/uracil permease family protein (.1) AT2G26510 42 / 3e-06 PDE135 pigment defective embryo 135, Xanthine/uracil permease family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043460 [exp] 99 / 4e-26 AT5G62890 892 / 0.0 Xanthine/uracil permease family protein (.1.2.3.4) Lus10034125 [exp] 99 / 5e-26 AT1G49960 944 / 0.0 Xanthine/uracil permease family protein (.1) Lus10004228 [exp] 96 / 7e-25 AT5G62890 972 / 0.0 Xanthine/uracil permease family protein (.1.2.3.4) Lus10042138 [exp] 94 / 2e-24 AT5G62890 932 / 0.0 Xanthine/uracil permease family protein (.1.2.3.4) Lus10029191 [exp] 81 / 9e-20 AT5G62890 914 / 0.0 Xanthine/uracil permease family protein (.1.2.3.4) Lus10010707 [exp] 81 / 1e-19 AT5G62890 916 / 0.0 Xanthine/uracil permease family protein (.1.2.3.4) Lus10035311 [exp] 52 / 1e-09 AT2G05760 867 / 0.0 Xanthine/uracil permease family protein (.1) Lus10007289 [exp] 52 / 1e-09 AT2G34190 512 / 0.0 Xanthine/uracil permease family protein (.1) Lus10030014 [exp] 52 / 2e-09 AT2G05760 927 / 0.0 Xanthine/uracil permease family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G072600 [exp] 94 / 2e-24 AT5G62890 908 / 0.0 Xanthine/uracil permease family protein (.1.2.3.4) Potri.012G077400 [exp] 94 / 3e-24 AT5G62890 914 / 0.0 Xanthine/uracil permease family protein (.1.2.3.4) Potri.008G146400 [exp] 84 / 1e-20 AT1G60030 881 / 0.0 ARABIDOPSIS NUCLEOBASE-ASCORBATE TRANSPORTER 7, nucleobase-ascorbate transporter 7 (.1) Potri.010G095500 [exp] 79 / 4e-19 AT1G60030 869 / 0.0 ARABIDOPSIS NUCLEOBASE-ASCORBATE TRANSPORTER 7, nucleobase-ascorbate transporter 7 (.1) Potri.014G015100 [exp] 55 / 1e-10 AT1G65550 559 / 0.0 Xanthine/uracil permease family protein (.1) Potri.011G068200 [exp] 54 / 3e-10 AT2G34190 928 / 0.0 Xanthine/uracil permease family protein (.1) Potri.014G157800 [exp] 53 / 5e-10 AT2G05760 930 / 0.0 Xanthine/uracil permease family protein (.1) Potri.004G058800 [exp] 53 / 5e-10 AT2G34190 927 / 0.0 Xanthine/uracil permease family protein (.1) Potri.009G086800 [exp] 53 / 6e-10 AT1G49960 727 / 0.0 Xanthine/uracil permease family protein (.1) Potri.014G035800 [exp] 47 / 1e-07 AT2G26510 734 / 0.0 pigment defective embryo 135, Xanthine/uracil permease family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005717 pacid=23175366 polypeptide=Lus10005717 locus=Lus10005717.g ID=Lus10005717.BGIv1.0 annot-version=v1.0 ATGCAGTCTCTGCTCTTCGTTTGTGGTTTGAACACATTGCTTCAGAGTATGTTTGGCACTAGGTTGCCTGCTGTTATTAGAGGATCTTACACTTTTGTCC CTACAACGATTTCAATCATCCTCGCTGGTCGATTTAGTGACAACATAGACCCTGTTGAGATTTGTTTCAATCACCCTGGTCTGCTCGTGCTCTTGGATTA G
AA sequence Show only first row Show all	>Lus10005717 pacid=23175366 polypeptide=Lus10005717 locus=Lus10005717.g ID=Lus10005717.BGIv1.0 annot-version=v1.0 MQSLLFVCGLNTLLQSMFGTRLPAVIRGSYTFVPTTISIILAGRFSDNIDPVEICFNHPGLLVLLD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G60030		ATNAT7	ARABIDOPSIS NUCLEOBASE-ASCORBA...		Lus10005717 [exp]	0	1
AT2G22590			UDP-Glycosyltransferase superf...		Lus10043446 [exp]	1.0	0.9121
AT2G30860		GLUTTR, ATGSTF7...	glutathione S-transferase PHI ...		Lus10020736 [exp]	2.4	0.9062
AT2G40080		ELF4	EARLY FLOWERING 4, Protein of ...		Lus10028288 [exp]	3.2	0.8627
AT5G65550			UDP-Glycosyltransferase superf...		Lus10028864 [exp]	3.5	0.8937
AT5G15070			Phosphoglycerate mutase-like f...		Lus10005263 [exp]	3.7	0.8554
AT4G25030			unknown protein		Lus10034730 [exp]	4.9	0.8510
AT2G19130			S-locus lectin protein kinase ...		Lus10012955 [exp]	6.3	0.8680
AT1G74400			Tetratricopeptide repeat (TPR)...		Lus10002903 [exp]	7.3	0.7922
AT1G65390		ATPP2-A5	phloem protein 2 A5 (.1.2)		Lus10040606 [exp]	7.5	0.8259
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10018547 [exp]	7.9	0.8491

Compare expression of checked genes

Lus10005717 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.