Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47650 117 / 5e-35 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030091 [exp] 201 / 4e-68 AT3G47650 129 / 3e-39 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Lus10019417 [exp] 137 / 1e-42 AT3G47650 128 / 2e-38 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Lus10002906 [exp] 106 / 9e-31 AT3G47650 109 / 1e-31 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Lus10043274 [exp] 106 / 1e-30 AT3G47650 107 / 1e-30 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Lus10002020 [exp] 87 / 9e-24 AT3G47650 90 / 7e-25 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Lus10026899 [exp] 41 / 3e-05 AT2G24860 154 / 6e-49 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G068300 [exp] 136 / 1e-42 AT3G47650 140 / 9e-44 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Potri.018G028500 [exp] 113 / 2e-33 AT3G47650 120 / 4e-36 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Potri.018G016400 [exp] 39 / 0.0001 AT2G24860 165 / 5e-53 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Potri.006G266800 [exp] 39 / 0.0002 AT2G24860 167 / 3e-54 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005719 pacid=23175370 polypeptide=Lus10005719 locus=Lus10005719.g ID=Lus10005719.BGIv1.0 annot-version=v1.0 ATGGCGGTGGCTGTAGGTATTATTGGGAATTTTGCTGCTGGGAAAGTTCTTCGAGTAAACAAAGCTTTCGAAACCTCCAAAACTCCAAAGTCCAGGTCTT TGGAGGTCAAGGCGACTGCTGACGATAGCAAAACCACGAAAACAAGGAGCATCGTCTGTGCTGACTGTGAAGGCAACGGGGCTGTAGCATGTTCCCAGTG CAAAGGTGCAGGTGTAAACTCTGAGGACCACTTCAATGGGCGGTTTAAAGCTGGTGGATTATGCTGGTTATGCAGAGGTAAAAGGGAGATGCTGTGCGGG AACTGCAACGGGGCTGGATTCGTTGGGGGATTCATGAACAGCTGA
AA sequence Show only first row Show all	>Lus10005719 pacid=23175370 polypeptide=Lus10005719 locus=Lus10005719.g ID=Lus10005719.BGIv1.0 annot-version=v1.0 MAVAVGIIGNFAAGKVLRVNKAFETSKTPKSRSLEVKATADDSKTTKTRSIVCADCEGNGAVACSQCKGAGVNSEDHFNGRFKAGGLCWLCRGKREMLCG NCNGAGFVGGFMNS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G47650			DnaJ/Hsp40 cysteine-rich domai...		Lus10005719 [exp]	0	1
AT3G44890		RP19, RPL9	ribosomal protein L9 (.1)		Lus10041346 [exp]	1.4	0.9872
AT3G60370			FKBP-like peptidyl-prolyl cis-...		Lus10042897 [exp]	2.0	0.9830
AT5G11450		PPD5	PsbP domain protein 5, Mog1/Ps...		Lus10001861 [exp]	2.4	0.9798
AT3G47650			DnaJ/Hsp40 cysteine-rich domai...		Lus10030091 [exp]	2.6	0.9742
AT5G14910			Heavy metal transport/detoxifi...		Lus10014520 [exp]	4.5	0.9783
AT1G50900		LTD, GDC1	LHCP translocation defect, Gra...		Lus10011151 [exp]	4.7	0.9694
AT4G21445			unknown protein		Lus10002594 [exp]	4.9	0.9687
AT4G34620		SSR16	small subunit ribosomal protei...		Lus10027058 [exp]	7.4	0.9776
AT3G44890		RP19, RPL9	ribosomal protein L9 (.1)		Lus10037372 [exp]	7.7	0.9698
AT1G75350		EMB2184	embryo defective 2184, Ribosom...		Lus10010639 [exp]	7.7	0.9767

Compare expression of checked genes

Lus10005719 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.