Plant FIBer expression Database

Lus10005737 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26130 66 / 2e-14 Cellulase (glycosyl hydrolase family 5) protein (.1)
AT1G13130 59 / 4e-12 Cellulase (glycosyl hydrolase family 5) protein (.1)
AT3G26140 59 / 6e-12 Cellulase (glycosyl hydrolase family 5) protein (.1)
AT5G17500 56 / 5e-11 Glycosyl hydrolase superfamily protein (.1)
AT5G16700 48 / 5e-08 Glycosyl hydrolase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024686
[exp]
117 / 2e-32 AT3G26140 364 / 4e-120 Cellulase (glycosyl hydrolase family 5) protein (.1)
Lus10032312
[exp]
92 / 1e-23 AT3G26140 298 / 2e-95 Cellulase (glycosyl hydrolase family 5) protein (.1)
Lus10011403
[exp]
63 / 3e-13 AT1G13130 610 / 0.0 Cellulase (glycosyl hydrolase family 5) protein (.1)
Lus10006461
[exp]
60 / 3e-12 AT1G13130 612 / 0.0 Cellulase (glycosyl hydrolase family 5) protein (.1)
Lus10006462
[exp]
59 / 1e-11 AT1G13130 601 / 0.0 Cellulase (glycosyl hydrolase family 5) protein (.1)
Lus10011404
[exp]
59 / 1e-11 AT1G13130 605 / 0.0 Cellulase (glycosyl hydrolase family 5) protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G183400
[exp]
62 / 7e-13 AT1G13130 676 / 0.0 Cellulase (glycosyl hydrolase family 5) protein (.1)
Potri.010G049700
[exp]
62 / 7e-13 AT1G13130 679 / 0.0 Cellulase (glycosyl hydrolase family 5) protein (.1)
Potri.010G049800
[exp]
61 / 1e-12 AT1G13130 544 / 0.0 Cellulase (glycosyl hydrolase family 5) protein (.1)
Potri.001G097901
[exp]
47 / 8e-08 AT1G13130 393 / 2e-131 Cellulase (glycosyl hydrolase family 5) protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Representative CDS sequence
>Lus10005737 pacid=23175252 polypeptide=Lus10005737 locus=Lus10005737.g ID=Lus10005737.BGIv1.0 annot-version=v1.0
ATGGTGGGGATGGAATTGAGGAACGAGCTACCTGGCGAGAAGCAGGATGAGGAAACATGGCGAAAATACGTAACACTTGTAGGAACCGCGATAAAGGGAG
TAAACTCTAACGTGTTAATATTCTCAGGAGGGATAAGCTACGCATTAATGCTCGCCTTCCTAAAGAACAAACCTCCGACCACAAATTTCGGCAACAAGTT
GGTGTACAAAGCCCACTAG
AA sequence
>Lus10005737 pacid=23175252 polypeptide=Lus10005737 locus=Lus10005737.g ID=Lus10005737.BGIv1.0 annot-version=v1.0
MVGMELRNELPGEKQDEETWRKYVTLVGTAIKGVNSNVLIFSGGISYALMLAFLKNKPPTTNFGNKLVYKAH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Download tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G26130 Cellulase (glycosyl hydrolase ... Lus10005737
[exp]
0 1

Lus10005737 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.