Lus10005763 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G52160 71 / 1e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT5G62080 66 / 2e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT5G07230 59 / 7e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027434 138 / 3e-40 AT1G12740 342 / 3e-113 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G139100 84 / 8e-23 AT5G52160 91 / 2e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.012G137400 77 / 3e-20 AT5G52160 87 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G008500 39 / 8e-05 AT2G44290 155 / 6e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.003G217000 39 / 9e-05 AT1G55260 149 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF00234 Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence
>Lus10005763 pacid=23169812 polypeptide=Lus10005763 locus=Lus10005763.g ID=Lus10005763.BGIv1.0 annot-version=v1.0
ATGGCATCTAATTCATCATCTTTGGCCTTGCTGCTGATCGTTGCAGCACTTGCAGCCACAGCAGTTGACGCCCAAGGGGGTACGTCGTCATGTCCAGTCC
AACTCAGCAACCTCAACGTCTGTGCGCCGTTCGTCGTGCCGGGGGCAGCCGCTCCGAATACGGAGTGTTGCTCTGCCATCCAGTCCGTACAGACTGACTG
CCTCTGCAGCACTCTTCAGATCACTGCAAGGCTTCCTTCCCTCTGTAGCCTCCCCACCATCGCTTGCCCTTTACCGAATTGGTAA
AA sequence
>Lus10005763 pacid=23169812 polypeptide=Lus10005763 locus=Lus10005763.g ID=Lus10005763.BGIv1.0 annot-version=v1.0
MASNSSSLALLLIVAALAATAVDAQGGTSSCPVQLSNLNVCAPFVVPGAAAPNTECCSAIQSVQTDCLCSTLQITARLPSLCSLPTIACPLPNW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62080 Bifunctional inhibitor/lipid-t... Lus10005763 0 1

Lus10005763 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.