Lus10005773 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G52790 205 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52800 194 / 4e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G80320 190 / 2e-58 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G03070 181 / 7e-55 AOP1.1, AOP1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G15540 174 / 2e-52 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52820 171 / 8e-51 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G28030 146 / 3e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52810 128 / 6e-35 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G03050 95 / 2e-22 AOP3 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G14130 84 / 2e-18 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005776 505 / 0 AT1G52790 198 / 2e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005774 457 / 3e-164 AT1G52790 144 / 2e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021025 324 / 1e-110 AT1G52800 226 / 2e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027419 226 / 7e-75 AT1G52800 89 / 4e-22 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10016659 179 / 3e-54 AT1G52820 445 / 1e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10023024 176 / 1e-52 AT1G52820 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005775 159 / 2e-49 AT1G52800 70 / 1e-15 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10041281 154 / 2e-45 AT1G52790 298 / 5e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005516 154 / 9e-44 AT1G52820 278 / 7e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G176000 220 / 6e-70 AT1G52790 460 / 2e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176500 219 / 1e-69 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176200 197 / 3e-61 AT1G52820 496 / 8e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176100 191 / 6e-59 AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G175900 191 / 8e-59 AT1G52820 328 / 2e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G175800 185 / 2e-56 AT1G52820 338 / 2e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.018G033400 181 / 9e-55 AT1G52820 269 / 4e-89 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G248000 178 / 5e-53 AT1G52820 280 / 6e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.008G029700 85 / 2e-18 AT2G36690 478 / 1e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G451500 84 / 4e-18 AT4G10500 325 / 2e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10005773 pacid=23169821 polypeptide=Lus10005773 locus=Lus10005773.g ID=Lus10005773.BGIv1.0 annot-version=v1.0
ATGGCAGCTCCCAGCAGTATTCCTGTTATATATTTCTCGGGAGTGAAGCCGGGAACCAATTCATGGGTTTCTGCTCGGACAACCGTGAGAAGGGCGATGG
AAGAGGTCGGGTGTTTCAAGGCCATATACACCGGTGCCGGCGAGATTTCGATTTTCGAGACAGTAAAAGAGCTGTTCGATCTTCCAGATGAGATAAAAAA
CAAGAACACCAGCACTAAGCCCTTTTTCGGAGGTTCCGTGCTGAGTCCTCTCAACAGTCATACTCACGAATCACTAGGAATCGATAACCCGACAAGCCTC
GATACCACTCAAGGCTTCACCAATCTTATGTGGCCGGATTCTGGAAATGATGCCTTCTGCCAGTCGAGTCTTTCCATGTCGAAGCTAATGGTGGAACTAT
TCGACATGATATTGAAGATGGTGATGGAAAGCTACGAGGTTGTCGAATCAGGGTTTGGACCTGAGTCGATGAATCACCAAATTCGATACTCCAAGTACCC
CTTGCCGTCGTCTAATCAAACCTCCGCTACTGATCTGAGCCTCACTCCTCATACAGATTTTACCTTTACGTCCATACTTCATCAGAACCAAGTCAACGGC
TTGCAAATCAAACCACCGAACGATCCACAACGTTGGGTTGGCGTTGACCTTACTACGCCGTCGTCCTTCTTGGTTTTCGCAGGGGATGCACTCATGGCAT
GGAGTAATAACAGAATACAAAGTGTATTGCATCAAGTAATACGATCAAAGGGAAAGGAAGTAAGGTACAGTGCTGGACTAGTTTCTTACGTGAAGAAAGG
CACCAAGATCCAGCCGCCCAAGGAGTTTGTGGATGAAGCTCATCCTCTGGGATACAAACCTTTTGATCACTTTGAATATCTTGAAACCTTATACAAAACC
CTAAGTATGAAGAAGCCTGATGTTAGGATCAAGGATTGTTATGGTTTGCTCCAATAA
AA sequence
>Lus10005773 pacid=23169821 polypeptide=Lus10005773 locus=Lus10005773.g ID=Lus10005773.BGIv1.0 annot-version=v1.0
MAAPSSIPVIYFSGVKPGTNSWVSARTTVRRAMEEVGCFKAIYTGAGEISIFETVKELFDLPDEIKNKNTSTKPFFGGSVLSPLNSHTHESLGIDNPTSL
DTTQGFTNLMWPDSGNDAFCQSSLSMSKLMVELFDMILKMVMESYEVVESGFGPESMNHQIRYSKYPLPSSNQTSATDLSLTPHTDFTFTSILHQNQVNG
LQIKPPNDPQRWVGVDLTTPSSFLVFAGDALMAWSNNRIQSVLHQVIRSKGKEVRYSAGLVSYVKKGTKIQPPKEFVDEAHPLGYKPFDHFEYLETLYKT
LSMKKPDVRIKDCYGLLQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G52790 2-oxoglutarate (2OG) and Fe(II... Lus10005773 0 1
AT4G23340 2-oxoglutarate (2OG) and Fe(II... Lus10009663 8.2 0.8644
AT3G58190 AS2 LBD29, ASL16 ASYMMETRIC LEAVES 2-LIKE 16, l... Lus10000613 9.3 0.8606
AT3G29034 unknown protein Lus10033010 13.2 0.8615
AT5G54510 DFL1, GH3.6 DWARF IN LIGHT 1, Auxin-respon... Lus10018510 20.3 0.8448
Lus10008694 20.4 0.8135
AT3G60820 PBF1 N-terminal nucleophile aminohy... Lus10030272 21.1 0.7753
AT1G01490 Heavy metal transport/detoxifi... Lus10014967 21.2 0.8415
AT4G25560 MYB LAF1, ATMYB18 LONG AFTER FAR-RED LIGHT 1, my... Lus10027458 22.6 0.8393
AT1G52790 2-oxoglutarate (2OG) and Fe(II... Lus10005774 22.6 0.8381
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Lus10030440 24.1 0.7567

Lus10005773 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.