Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52800 69 / 2e-15 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52790 65 / 5e-14 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G03070 61 / 2e-12 AOP1.1, AOP1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G15540 56 / 2e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G80320 50 / 1e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52820 49 / 5e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G28030 47 / 2e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52810 44 / 1e-06 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G03050 41 / 2e-05 AOP3 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027419 [exp] 166 / 6e-55 AT1G52800 89 / 4e-22 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005776 [exp] 170 / 6e-54 AT1G52790 198 / 2e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005774 [exp] 159 / 2e-50 AT1G52790 144 / 2e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005773 [exp] 159 / 9e-50 AT1G52790 205 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021025 [exp] 103 / 3e-28 AT1G52800 226 / 2e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023024 [exp] 52 / 3e-09 AT1G52820 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10013130 [exp] 51 / 8e-09 AT1G52820 200 / 3e-62 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005516 [exp] 50 / 2e-08 AT1G52820 278 / 7e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10016659 [exp] 49 / 3e-08 AT1G52820 445 / 1e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G176000 [exp] 77 / 2e-18 AT1G52790 460 / 2e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176500 [exp] 76 / 5e-18 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.018G033400 [exp] 59 / 8e-12 AT1G52820 269 / 4e-89 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176200 [exp] 59 / 8e-12 AT1G52820 496 / 8e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G248000 [exp] 56 / 1e-10 AT1G52820 280 / 6e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G175900 [exp] 52 / 2e-09 AT1G52820 328 / 2e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176100 [exp] 52 / 4e-09 AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G175800 [exp] 49 / 2e-08 AT1G52820 338 / 2e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005775 pacid=23169845 polypeptide=Lus10005775 locus=Lus10005775.g ID=Lus10005775.BGIv1.0 annot-version=v1.0 ATGGAAGAGTTCGGCTGTTTCCAGGCCATATACACCGGTGCCAGCAAGATTCCGATTTTCGAGACAGTAAAAGAGCTGTTCGATCTTCCAGATGATATAA AAAACAAGAACACCAGCACGAAGCCCTTTTTCGGGGGTTCAGTGCGGAGTCCTCTCCACAGTCATACTCAAGAATCACTAGGGATTGATAACCCGACAAG CCTCGATACCACTCGGGGCTTCGCCGATCTTATGTGGCCGGATTCTGGGAATGATGCTTTCTGGTAA
AA sequence Show only first row Show all	>Lus10005775 pacid=23169845 polypeptide=Lus10005775 locus=Lus10005775.g ID=Lus10005775.BGIv1.0 annot-version=v1.0 MEEFGCFQAIYTGASKIPIFETVKELFDLPDDIKNKNTSTKPFFGGSVRSPLHSHTQESLGIDNPTSLDTTRGFADLMWPDSGNDAFW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G52800			2-oxoglutarate (2OG) and Fe(II...		Lus10005775 [exp]	0	1
AT1G52790			2-oxoglutarate (2OG) and Fe(II...		Lus10005776 [exp]	3.5	0.7726
AT2G12646			PLATZ transcription factor fam...		Lus10000261 [exp]	12.6	0.7064
AT3G29000			Calcium-binding EF-hand family...		Lus10026974 [exp]	20.1	0.7809
AT2G44890		CYP704A1	"cytochrome P450, family 704, ...		Lus10038000 [exp]	26.7	0.7638
					Lus10026442 [exp]	28.2	0.7518
AT2G31260		ATAPG9, APG9	autophagy 9 (APG9) (.1)		Lus10000709 [exp]	31.0	0.7284
AT4G25590		ADF7	actin depolymerizing factor 7 ...		Lus10014977 [exp]	39.8	0.7264
AT1G30825		DIS2, ARPC2, AR...	DISTORTED TRICHOMES 2, ACTIN-R...		Lus10002867 [exp]	40.9	0.7474
AT2G27035		AtENODL20	early nodulin-like protein 20 ...		Lus10025536 [exp]	44.1	0.6708
AT1G49320		ATUSPL1	unknown seed protein like 1 (....		Lus10032324 [exp]	57.5	0.7176

Compare expression of checked genes

Lus10005775 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.