Lus10005781 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53590 71 / 4e-16 SAUR-like auxin-responsive protein family (.1)
AT4G00880 68 / 3e-15 SAUR-like auxin-responsive protein family (.1)
AT3G61900 65 / 5e-14 SAUR-like auxin-responsive protein family (.1)
AT2G46690 64 / 7e-14 SAUR-like auxin-responsive protein family (.1)
AT4G34800 62 / 2e-13 SAUR-like auxin-responsive protein family (.1)
AT5G20810 62 / 2e-12 SAUR-like auxin-responsive protein family (.1.2)
AT4G34770 60 / 3e-12 SAUR-like auxin-responsive protein family (.1)
AT3G03820 59 / 3e-12 SAUR-like auxin-responsive protein family (.1)
AT2G21210 59 / 3e-12 SAUR-like auxin-responsive protein family (.1)
AT4G34790 59 / 4e-12 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006820 199 / 5e-67 AT5G53590 69 / 5e-16 SAUR-like auxin-responsive protein family (.1)
Lus10010110 65 / 4e-14 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1)
Lus10007561 60 / 2e-12 AT4G34810 125 / 1e-38 SAUR-like auxin-responsive protein family (.1)
Lus10012185 59 / 3e-12 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1)
Lus10007560 59 / 4e-12 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1)
Lus10042376 59 / 6e-12 AT4G34770 136 / 3e-43 SAUR-like auxin-responsive protein family (.1)
Lus10025909 58 / 2e-11 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1)
Lus10009620 57 / 2e-11 AT4G38840 112 / 5e-34 SAUR-like auxin-responsive protein family (.1)
Lus10034888 59 / 3e-11 AT5G20810 210 / 2e-70 SAUR-like auxin-responsive protein family (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G002201 123 / 3e-37 AT5G53590 74 / 8e-18 SAUR-like auxin-responsive protein family (.1)
Potri.001G306300 120 / 4e-36 AT5G53590 75 / 2e-18 SAUR-like auxin-responsive protein family (.1)
Potri.002G176400 71 / 2e-16 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1)
Potri.014G103300 70 / 3e-16 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 69 / 6e-16 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 70 / 8e-16 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
Potri.003G167400 66 / 6e-14 AT5G50760 100 / 4e-27 SAUR-like auxin-responsive protein family (.1)
Potri.009G126400 63 / 8e-14 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1)
Potri.009G127400 63 / 1e-13 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
Potri.004G165500 62 / 2e-13 AT4G34770 115 / 7e-35 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10005781 pacid=23174722 polypeptide=Lus10005781 locus=Lus10005781.g ID=Lus10005781.BGIv1.0 annot-version=v1.0
ATGCAAGAGAAGAACATGAAGATGAAGAAAGGTTGCATAGCTGTCCAAGTAGGGCTAGAGGACGAAGATGATCAAGCAATCCTTCTACCTTCAATCATGC
AAGAGAAGAACATGAAGATGAAGAAAGGTTGCATAGCTGTCCAAGTAGGGTTAGAGGAAGAAGATGATCAAGCAAGTAGAAGGAAGTTTGTGATCCCAAT
TTCATACCTTTACCACCCACTTTTCAAGTCTCTTCTTGACAAGGCCTATGAGGTGTTTGGCTACCATGTGGCAGGCCCACTCAGGCTGCCTTGCTCCGTC
GACGACTTCCTCCACCTCCGGTGGCAGATCGAGAGGGAGTCCGACCACCACAACCACCATCAGCGCGAGCTCCACCGTGGGAGAAGCTCTGGCCACCACC
ACCACCATCATCATGTTCTTCAAACTGCCTTTTCTTTCAATTCTTGTTAG
AA sequence
>Lus10005781 pacid=23174722 polypeptide=Lus10005781 locus=Lus10005781.g ID=Lus10005781.BGIv1.0 annot-version=v1.0
MQEKNMKMKKGCIAVQVGLEDEDDQAILLPSIMQEKNMKMKKGCIAVQVGLEEEDDQASRRKFVIPISYLYHPLFKSLLDKAYEVFGYHVAGPLRLPCSV
DDFLHLRWQIERESDHHNHHQRELHRGRSSGHHHHHHHVLQTAFSFNSC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G53590 SAUR-like auxin-responsive pro... Lus10005781 0 1
AT3G07360 ATPUB9 ARABIDOPSIS THALIANA PLANT U-B... Lus10038218 5.6 0.7933
AT5G16550 unknown protein Lus10033497 7.0 0.7416
AT1G26800 RING/U-box superfamily protein... Lus10037170 14.8 0.7615
AT1G49230 RING/U-box superfamily protein... Lus10005817 24.2 0.7437
AT3G59910 Ankyrin repeat family protein ... Lus10005306 24.5 0.6696
AT1G70000 MYB myb-like transcription factor ... Lus10010733 28.0 0.7522
AT5G10050 NAD(P)-binding Rossmann-fold s... Lus10004925 31.1 0.7118
AT3G09770 LOG2 LOSS OF GDU 2, RING/U-box supe... Lus10041300 31.4 0.6861
AT3G12920 BRG3 BOI-related gene 3, SBP (S-rib... Lus10031202 33.2 0.7271
AT5G43150 unknown protein Lus10041628 33.5 0.7213

Lus10005781 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.