Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13880 43 / 5e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G42920 41 / 2e-05 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G08510 40 / 6e-05 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G03580 40 / 8e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G59720 39 / 0.0001 CRR28 CHLORORESPIRATORY REDUCTION28, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G03880 39 / 0.0001 REME1 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G35030 39 / 0.0001 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G18520 39 / 0.0002 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G53360 39 / 0.0002 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G22690 39 / 0.0002 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011025 [exp] 45 / 3e-07 AT2G13600 77 / 1e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10007840 [exp] 42 / 1e-05 AT5G55740 579 / 0.0 chlororespiratory reduction 21, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10009290 [exp] 41 / 4e-05 AT2G45350 605 / 0.0 CHLORORESPIRATORY REDUCTION 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10004751 [exp] 41 / 4e-05 AT5G55740 577 / 0.0 chlororespiratory reduction 21, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10034408 [exp] 41 / 4e-05 AT5G42450 538 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10015874 [exp] 41 / 4e-05 AT2G45350 687 / 0.0 CHLORORESPIRATORY REDUCTION 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10033982 [exp] 40 / 6e-05 AT2G36980 554 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10019149 [exp] 40 / 6e-05 AT1G13560 477 / 7e-165 aminoalcoholphosphotransferase 1 (.1.2) Lus10021232 [exp] 40 / 7e-05 AT2G33680 818 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G103600 [exp] 43 / 6e-06 AT1G08070 477 / 7e-160 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G064301 [exp] 42 / 7e-06 AT2G34400 170 / 7e-51 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.002G175900 [exp] 42 / 1e-05 AT5G08510 608 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.018G144401 [exp] 40 / 3e-05 AT2G34400 164 / 9e-49 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.009G139200 [exp] 41 / 4e-05 AT1G62260 749 / 0.0 mitochondrial editing factor 9 (.1) Potri.012G140400 [exp] 40 / 4e-05 AT3G29230 398 / 2e-132 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G129500 [exp] 40 / 5e-05 AT5G09950 1001 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G145510 [exp] 40 / 5e-05 AT2G34400 462 / 3e-158 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.014G068800 [exp] 40 / 5e-05 AT2G45350 735 / 0.0 CHLORORESPIRATORY REDUCTION 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.012G108000 [exp] 40 / 5e-05 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10005785 pacid=23174741 polypeptide=Lus10005785 locus=Lus10005785.g ID=Lus10005785.BGIv1.0 annot-version=v1.0 ATGCCTGAACGAAATCTCGTCAGCTACAACTCAATGATTTCGGGGCTTTCTCGTGGTGGGTATTACACGGAGGCGTTGGGGATGTTCATGAGGGTGGAGG GAGGTTTGGGTGGGGGGGTTTTAAGATTGCGTTGGTGGGTTTTGTTTGGAAGAGTTTACTGTTGCAAGTGTGGCGAGTTGTTGTGCGAGCTTTCGTGGGT TGGGACTGGTTCGTCAGCTGCATGGTGTGGGGTTAGTTCTTGGGCTGGAAAAGAATCTGGTGTTGCTAAATTCCTTGATTGA
AA sequence Show only first row Show all	>Lus10005785 pacid=23174741 polypeptide=Lus10005785 locus=Lus10005785.g ID=Lus10005785.BGIv1.0 annot-version=v1.0 MPERNLVSYNSMISGLSRGGYYTEALGMFMRVEGGLGGGVLRLRWWVLFGRVYCCKCGELLCELSWVGTGSSAAWCGVSSWAGKESGVAKFLD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10005785 [exp]	0	1
AT4G38900	bZIP	AtbZIP29	Basic-leucine zipper (bZIP) tr...		Lus10012391 [exp]	3.2	0.8484
AT2G20300		ALE2	Abnormal Leaf Shape 2, Protein...		Lus10022848 [exp]	3.2	0.8476
AT4G38900	bZIP	AtbZIP29	Basic-leucine zipper (bZIP) tr...		Lus10012390 [exp]	5.2	0.8421
AT4G32285			ENTH/ANTH/VHS superfamily prot...		Lus10043260 [exp]	5.3	0.8162
AT5G04050			RNA-directed DNA polymerase (r...		Lus10036278 [exp]	8.1	0.8193
AT4G11170			Disease resistance protein (TI...		Lus10010222 [exp]	12.2	0.8303
AT3G12620			Protein phosphatase 2C family ...		Lus10023470 [exp]	14.3	0.7932
AT1G72890			Disease resistance protein (TI...		Lus10009384 [exp]	14.5	0.7916
AT1G05170			Galactosyltransferase family p...		Lus10002079 [exp]	15.8	0.8092
AT1G75860			unknown protein		Lus10034539 [exp]	17.9	0.8251

Compare expression of checked genes

Lus10005785 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.