Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09890 66 / 1e-15 Protein of unknown function (DUF3511) (.1) AT3G05725 52 / 9e-10 Protein of unknown function (DUF3511) (.1) AT5G11970 50 / 2e-09 Protein of unknown function (DUF3511) (.1) AT2G47480 49 / 6e-09 Protein of unknown function (DUF3511) (.1) AT2G19460 49 / 1e-08 Protein of unknown function (DUF3511) (.1) AT1G72720 45 / 2e-07 Protein of unknown function (DUF3511) (.1) AT3G13910 44 / 4e-07 Protein of unknown function (DUF3511) (.1) AT3G62640 43 / 1e-06 Protein of unknown function (DUF3511) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006799 [exp] 142 / 4e-46 AT4G09890 70 / 2e-17 Protein of unknown function (DUF3511) (.1) Lus10033529 [exp] 103 / 1e-30 AT4G09890 70 / 2e-17 Protein of unknown function (DUF3511) (.1) Lus10020842 [exp] 91 / 5e-25 AT4G09890 69 / 2e-16 Protein of unknown function (DUF3511) (.1) Lus10028690 [exp] 60 / 1e-13 AT4G09890 71 / 1e-17 Protein of unknown function (DUF3511) (.1) Lus10028734 [exp] 58 / 1e-12 AT4G09890 69 / 8e-17 Protein of unknown function (DUF3511) (.1) Lus10011939 [exp] 50 / 5e-09 AT2G19460 109 / 6e-32 Protein of unknown function (DUF3511) (.1) Lus10027629 [exp] 50 / 5e-09 AT2G19460 110 / 2e-32 Protein of unknown function (DUF3511) (.1) Lus10008471 [exp] 47 / 4e-08 AT2G19460 95 / 1e-26 Protein of unknown function (DUF3511) (.1) Lus10031405 [exp] 47 / 5e-08 AT3G05725 71 / 6e-17 Protein of unknown function (DUF3511) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G077500 [exp] 103 / 1e-30 AT4G09890 80 / 3e-21 Protein of unknown function (DUF3511) (.1) Potri.002G065200 [exp] 81 / 8e-22 AT4G09890 84 / 9e-23 Protein of unknown function (DUF3511) (.1) Potri.005G195800 [exp] 80 / 2e-21 AT4G09890 81 / 1e-21 Protein of unknown function (DUF3511) (.1) Potri.001G197700 [exp] 52 / 3e-10 AT2G19460 78 / 1e-19 Protein of unknown function (DUF3511) (.1) Potri.014G123600 [exp] 50 / 4e-09 AT2G47480 93 / 5e-26 Protein of unknown function (DUF3511) (.1) Potri.006G147700 [exp] 49 / 7e-09 AT2G19460 96 / 2e-26 Protein of unknown function (DUF3511) (.1) Potri.003G043600 [exp] 49 / 9e-09 AT5G11970 89 / 5e-24 Protein of unknown function (DUF3511) (.1) Potri.005G019900 [exp] 48 / 9e-09 AT3G05725 63 / 3e-14 Protein of unknown function (DUF3511) (.1) Potri.006G225900 [exp] 47 / 4e-08 AT5G11970 90 / 2e-24 Protein of unknown function (DUF3511) (.1) Potri.010G140800 [exp] 46 / 5e-08 AT2G47480 62 / 2e-14 Protein of unknown function (DUF3511) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12023 [flax] [poplar] DUF3511 Domain of unknown function (DUF3511)
Representative CDS sequence Show only first row Show all	>Lus10005802 pacid=23174724 polypeptide=Lus10005802 locus=Lus10005802.g ID=Lus10005802.BGIv1.0 annot-version=v1.0 ATGATGATGGAGAAGAGCAGATCGTTCTCGGGGTATTCGGAGATGAGGAGGATGGGGTTCGAGCACAAGTCGAATTCGTACAGCTTTAACGGGGGAGCTG CTGAGCTTGGGAGTGGTAGTAGTGAGAATCCTGAGGTGAAAAGGAGGAAGAGAGTTGCTCAGTATAACGTCTACTCCAAAGAAGGTAAGCTCAAAACCTC TCTTAGAAACAGCTTCAAGTGGATCAAGAGCAAGTTCATTGACGACTACTTCCAAGACTGA
AA sequence Show only first row Show all	>Lus10005802 pacid=23174724 polypeptide=Lus10005802 locus=Lus10005802.g ID=Lus10005802.BGIv1.0 annot-version=v1.0 MMMEKSRSFSGYSEMRRMGFEHKSNSYSFNGGAAELGSGSSENPEVKRRKRVAQYNVYSKEGKLKTSLRNSFKWIKSKFIDDYFQD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G09890			Protein of unknown function (D...		Lus10005802 [exp]	0	1
AT3G55360		ECR, CER10, ATT...	ENOYL-COA REDUCTASE, ECERIFERU...		Lus10001695 [exp]	1.4	0.8958
AT1G78210			alpha/beta-Hydrolases superfam...		Lus10020926 [exp]	2.8	0.8384
					Lus10005391 [exp]	3.5	0.8697
AT5G10480		PEP, PAS2	PEPINO, PASTICCINO 2, Protein-...		Lus10025335 [exp]	3.5	0.8631
AT1G60010			unknown protein		Lus10029193 [exp]	4.0	0.8074
AT5G10480		PEP, PAS2	PEPINO, PASTICCINO 2, Protein-...		Lus10024408 [exp]	5.3	0.8392
AT1G68910		WIT2	WPP domain-interacting protein...		Lus10029109 [exp]	5.9	0.8570
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Lus10012871 [exp]	9.5	0.8635
AT5G52100		CRR1	chlororespiration reduction 1,...		Lus10027421 [exp]	10.4	0.8309
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10037473 [exp]	10.5	0.8275

Compare expression of checked genes

Lus10005802 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.