Plant FIBer expression Database

Lus10005803 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G22140 160 / 2e-47 ATEME1B essential meiotic endonuclease 1B (.1)
AT2G21800 149 / 2e-43 ATEME1A essential meiotic endonuclease 1A (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006798
[exp]
220 / 3e-70 AT2G22140 436 / 7e-148 essential meiotic endonuclease 1B (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G077400
[exp]
165 / 3e-49 AT2G22140 443 / 2e-150 essential meiotic endonuclease 1B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0236 PDDEXK PF02732 ERCC4 ERCC4 domain
Representative CDS sequence
>Lus10005803 pacid=23174742 polypeptide=Lus10005803 locus=Lus10005803.g ID=Lus10005803.BGIv1.0 annot-version=v1.0
ATGCTGGCAAAATTAACCACCCACTACGAGAAGGTATATCACAGGCACTGTAGAGATGAAGCTGAAGTTGCAGATCATGTGGTTGGTTTGACAAGTAGTT
TGGCTTCTTGTCAATACAGGCTAAAAGCTCTGGTTGCCATTCCCAAGGTGCAGCCTCGTTTTGCTGTTGCTATATCGAAGAAGTATACTACAGTGAAGTC
ATTGCTCAGGATTTATATGGACCCCAGTAAATCGGTTCATGAAAAGGAGTTTATGCTTGCTAACCTGCCAGCAGAAGGGATTGGAGGCGAAAGGAGAGTT
GGTGAAGTAACCTCAAAGCGAGTCTACAGAATACTGATGGCCGAGTCCGGAAGCATCAGAACCGAAGATGTCGAGAACGGTGCTGATTTCTTTCAGCGGT
AA
AA sequence
>Lus10005803 pacid=23174742 polypeptide=Lus10005803 locus=Lus10005803.g ID=Lus10005803.BGIv1.0 annot-version=v1.0
MLAKLTTHYEKVYHRHCRDEAEVADHVVGLTSSLASCQYRLKALVAIPKVQPRFAVAISKKYTTVKSLLRIYMDPSKSVHEKEFMLANLPAEGIGGERRV
GEVTSKRVYRILMAESGSIRTEDVENGADFFQR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G22140 ATEME1B essential meiotic endonuclease... Lus10005803
[exp]
0 1
AT3G12620 Protein phosphatase 2C family ... Lus10003993
[exp]
5.2 0.8234
AT3G55050 Protein phosphatase 2C family ... Lus10015047
[exp]
7.5 0.7971
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Lus10042922
[exp]
9.8 0.7384
AT5G51920 Pyridoxal phosphate (PLP)-depe... Lus10002958
[exp]
11.3 0.6038
AT3G03341 unknown protein Lus10028523
[exp]
12.6 0.7455
AT1G75540 CO LHUS, AtBBX21, ... long hypocotyl under shade, B-... Lus10028791
[exp]
13.1 0.7936
AT5G43700 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible... Lus10039488
[exp]
13.5 0.6975
Lus10026796
[exp]
18.9 0.7408
Lus10005748
[exp]
20.7 0.7242
AT4G37770 ACS8 1-amino-cyclopropane-1-carboxy... Lus10011565
[exp]
21.5 0.7432

Lus10005803 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.