Lus10005806 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G27990 101 / 4e-27 Pre-rRNA-processing protein TSR2, conserved region (.1)
AT3G22510 82 / 4e-20 Pre-rRNA-processing protein TSR2, conserved region (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006795 301 / 3e-105 AT5G27990 107 / 2e-29 Pre-rRNA-processing protein TSR2, conserved region (.1)
Lus10027901 119 / 2e-33 AT5G27990 79 / 3e-18 Pre-rRNA-processing protein TSR2, conserved region (.1)
Lus10002404 117 / 5e-33 AT5G27990 77 / 1e-17 Pre-rRNA-processing protein TSR2, conserved region (.1)
Lus10006124 88 / 5e-20 AT3G22520 340 / 4e-106 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G035000 193 / 1e-62 AT5G27990 126 / 1e-36 Pre-rRNA-processing protein TSR2, conserved region (.1)
Potri.005G047901 178 / 2e-56 AT5G27990 124 / 7e-36 Pre-rRNA-processing protein TSR2, conserved region (.1)
Potri.010G086800 115 / 7e-33 AT3G22510 98 / 2e-27 Pre-rRNA-processing protein TSR2, conserved region (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10273 WGG Pre-rRNA-processing protein TSR2
Representative CDS sequence
>Lus10005806 pacid=23174709 polypeptide=Lus10005806 locus=Lus10005806.g ID=Lus10005806.BGIv1.0 annot-version=v1.0
ATGAACGGCGGAGGAGACGCCGATAGCAGCTCAATCAAGCAGCTGACCTCCGAGGCACTTCCCGTGCTCAACGAAGGCATCTATTTGCTTCTCTCCAGAT
GGTCAGCTCTTCAGCTCGCAATCGAGAACGAGTGGGCCGGCCGCCGCTCCCGCCAGCTGGCCGATCAGTTCGCTGCCGATATCTTCGCCTGGTTCACTCA
ACCCAAAGCCGAACCGCTGTATATCGATGATCTAGAGAGCGTTTTAGACGAAGGGATGCTTACTTTCAACGTCGATGTTGACGATGGCAGCGTTGAGGAG
GTAGCTGAGAAATTGATGATTATGCATGAGGAATGTTTGGAAGGTAACTATAGATCCGTTGAGAAGTTGAGAACAGCAGGGCCTGGAGCAGGAATTCATC
AGCATCAAAGAGAGGCTGGAAATGACGATGAATCCTCGTCGGAGGACGATGACAGTGACAAAGAAGGAGGTAGATCAAGTATGCTGGTGGATCAACCAGT
TTCTCAGCCAAGGTCGAGTTCAGTGGTCGAGCCGGAGTGTAATGAAGCTCTGGGAGATGATGATGGGTGGACAGTCGTCTTGTCCAGTCGAAGCAAAGGC
AGAAGGAAGTAG
AA sequence
>Lus10005806 pacid=23174709 polypeptide=Lus10005806 locus=Lus10005806.g ID=Lus10005806.BGIv1.0 annot-version=v1.0
MNGGGDADSSSIKQLTSEALPVLNEGIYLLLSRWSALQLAIENEWAGRRSRQLADQFAADIFAWFTQPKAEPLYIDDLESVLDEGMLTFNVDVDDGSVEE
VAEKLMIMHEECLEGNYRSVEKLRTAGPGAGIHQHQREAGNDDESSSEDDDSDKEGGRSSMLVDQPVSQPRSSSVVEPECNEALGDDDGWTVVLSSRSKG
RRK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G27990 Pre-rRNA-processing protein TS... Lus10005806 0 1
AT5G56440 F-box/RNI-like/FBD-like domain... Lus10023425 3.0 0.8158
AT5G67220 FMN-linked oxidoreductases sup... Lus10006260 8.8 0.7985
AT5G05830 RING/FYVE/PHD zinc finger supe... Lus10028249 9.5 0.8012
AT1G20340 PETE2, DRT112 PLASTOCYANIN 2, DNA-DAMAGE-REP... Lus10034554 11.2 0.8347
AT5G66520 Tetratricopeptide repeat (TPR)... Lus10010909 11.5 0.8239
AT1G31830 Amino acid permease family pro... Lus10007593 17.3 0.7882
AT3G63540 Mog1/PsbP/DUF1795-like photosy... Lus10016419 19.7 0.8134
AT1G10020 Protein of unknown function (D... Lus10032807 22.0 0.7657
AT2G32070 Polynucleotidyl transferase, r... Lus10003635 22.7 0.7798
AT5G19020 MEF18 mitochondrial editing factor ... Lus10034022 24.2 0.7728

Lus10005806 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.