Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64667 60 / 4e-13 IDL2 inflorescence deficient in abscission (IDA)-like 2 (.1) AT3G18715 49 / 3e-09 IDL4 inflorescence deficient in abscission (IDA)-like 4 (.1) AT5G09805 42 / 2e-06 IDL3 inflorescence deficient in abscission (IDA)-like 3 (.1) AT1G76952 38 / 0.0002 IDL5 inflorescence deficient in abscission (IDA)-like 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033523 [exp] 66 / 1e-15 AT3G18715 51 / 8e-10 inflorescence deficient in abscission (IDA)-like 4 (.1) Lus10020848 [exp] 62 / 4e-14 AT3G18715 53 / 1e-10 inflorescence deficient in abscission (IDA)-like 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G057400 [exp] 74 / 9e-19 AT5G64667 59 / 5e-13 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.007G110700 [exp] 69 / 4e-17 AT5G64667 53 / 1e-10 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.005G189900 [exp] 45 / 2e-07 AT5G64667 47 / 1e-08 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.002G070401 [exp] 40 / 2e-05 AT5G64667 44 / 4e-07 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.010G131500 [exp] 37 / 0.0002 AT1G68765 49 / 3e-09 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005811 pacid=23174726 polypeptide=Lus10005811 locus=Lus10005811.g ID=Lus10005811.BGIv1.0 annot-version=v1.0 ATGGTAGCTCATGTCCATGATCATCACCAACCCACATCACATTTCTTCATGAAGATCATGTTGTTCTTGGTAATCTTCTTCTTGGTGTTGCTAGTTGGTG GAAGCCATGGATCTAGAGCAAGTACTAATGTCTTTAGAGTGAAGCCAAAGGGAGAGGAAGGAGGAGGAGGAGGAAGAGGTCATTTCGGTAATTTCCTCCC AAGGCATTTGCCCATCCCTACTTCTGGCCCTTCTAGGAGACACAATGAAATTGGGTTGCAAACTTGGAGTTCACCTTGA
AA sequence Show only first row Show all	>Lus10005811 pacid=23174726 polypeptide=Lus10005811 locus=Lus10005811.g ID=Lus10005811.BGIv1.0 annot-version=v1.0 MVAHVHDHHQPTSHFFMKIMLFLVIFFLVLLVGGSHGSRASTNVFRVKPKGEEGGGGGRGHFGNFLPRHLPIPTSGPSRRHNEIGLQTWSSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G64667		IDL2	inflorescence deficient in abs...		Lus10005811 [exp]	0	1
AT3G43660			Vacuolar iron transporter (VIT...		Lus10025685 [exp]	7.3	0.8422
AT2G44730	Trihelix		Alcohol dehydrogenase transcri...		Lus10000963 [exp]	8.0	0.8286
					Lus10040690 [exp]	8.8	0.8328
AT3G15810			Protein of unknown function (D...		Lus10032602 [exp]	10.1	0.8363
AT4G33920			Protein phosphatase 2C family ...		Lus10011521 [exp]	11.0	0.8133
AT2G02130		PDF2.3, LCR68	low-molecular-weight cysteine-...		Lus10019227 [exp]	12.0	0.8169
					Lus10018215 [exp]	18.3	0.8259
AT5G59845			Gibberellin-regulated family p...		Lus10018708 [exp]	19.6	0.7174
AT3G01470	HD	HD-ZIP-1, HAT5,...	HOMEODOMAIN PROTEIN FROM ARABI...		Lus10036674 [exp]	19.7	0.8275
AT5G18850			unknown protein		Lus10033997 [exp]	19.7	0.8283

Compare expression of checked genes

Lus10005811 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.