Lus10005818 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G49210 129 / 5e-38 RING/U-box superfamily protein (.1)
AT1G49200 127 / 6e-37 RING/U-box superfamily protein (.1)
AT1G49230 124 / 4e-36 RING/U-box superfamily protein (.1)
AT1G49220 125 / 5e-36 RING/U-box superfamily protein (.1)
AT3G18773 124 / 8e-36 RING/U-box superfamily protein (.1)
AT5G05280 102 / 9e-28 RING/U-box superfamily protein (.1)
AT5G01880 92 / 4e-24 RING/U-box superfamily protein (.1)
AT1G20823 92 / 6e-24 RING/U-box superfamily protein (.1)
AT1G76410 92 / 8e-24 ATL8 RING/U-box superfamily protein (.1)
AT3G10910 91 / 2e-23 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006788 185 / 1e-59 AT1G49230 214 / 2e-70 RING/U-box superfamily protein (.1)
Lus10005814 172 / 8e-55 AT1G49230 215 / 1e-70 RING/U-box superfamily protein (.1)
Lus10005815 168 / 2e-53 AT1G49230 170 / 3e-53 RING/U-box superfamily protein (.1)
Lus10006786 148 / 1e-45 AT1G49230 176 / 9e-56 RING/U-box superfamily protein (.1)
Lus10005816 145 / 3e-44 AT1G49230 169 / 5e-53 RING/U-box superfamily protein (.1)
Lus10005817 145 / 5e-44 AT1G49230 207 / 2e-67 RING/U-box superfamily protein (.1)
Lus10006785 144 / 1e-43 AT1G49230 197 / 7e-64 RING/U-box superfamily protein (.1)
Lus10033515 144 / 2e-43 AT1G49230 224 / 6e-74 RING/U-box superfamily protein (.1)
Lus10020859 144 / 3e-43 AT1G49230 230 / 3e-76 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G010500 143 / 2e-43 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1)
Potri.001G309600 140 / 3e-42 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1)
Potri.001G309700 134 / 7e-40 AT1G49230 196 / 2e-63 RING/U-box superfamily protein (.1)
Potri.019G010600 130 / 2e-38 AT1G49230 158 / 1e-48 RING/U-box superfamily protein (.1)
Potri.013G091300 99 / 1e-26 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1)
Potri.016G136200 96 / 2e-25 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1)
Potri.002G006400 95 / 1e-24 AT1G76410 177 / 1e-56 RING/U-box superfamily protein (.1)
Potri.005G099000 94 / 3e-24 AT1G20823 146 / 2e-44 RING/U-box superfamily protein (.1)
Potri.019G057700 93 / 3e-24 AT3G10910 157 / 6e-49 RING/U-box superfamily protein (.1)
Potri.019G130100 92 / 7e-24 AT5G05280 129 / 5e-38 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10005818 pacid=23174745 polypeptide=Lus10005818 locus=Lus10005818.g ID=Lus10005818.BGIv1.0 annot-version=v1.0
ATGCTCTCTCGGTCTCAACTCAATAATTCGGTGCGCTCTACGATGCTCCCACTTGGTACCCGCCGCCGGCGACCACCACCACCGGCCGCCGGCCAACAAC
TTCCGGCGACCGGAATAAAAAAGAAAGCGCTCAAGACCTTCCCCATCGTCACCTTCTCCTCCCGGTTGAACAACATGGACGACGAGTGCGTCATCTGCCT
GTCGGAGTTTGTCTCCGGCGACCGGGTCAAGATTCTGCCCAAGTGTAACCATGGGTTCCACGTCAAGTGTATTGACAAGTGGCTTGGTGATCACTCTTCT
TGTCCTACTTGCCGCCACTGCCTCATCGAGACCTGCAGGAAGATTGTCGCCGGCCAAGATTCTTCTTCTTCTACTCCTTCTCCGGCGGCTGGAGGTGTTG
TTATTGGTATGCCGCCAATGGAAGCTGAAGGCCCCGTACGGGAGCACAGAATATTTAAGAGTATGTTCTTTTGGAGGAAAAATTGA
AA sequence
>Lus10005818 pacid=23174745 polypeptide=Lus10005818 locus=Lus10005818.g ID=Lus10005818.BGIv1.0 annot-version=v1.0
MLSRSQLNNSVRSTMLPLGTRRRRPPPPAAGQQLPATGIKKKALKTFPIVTFSSRLNNMDDECVICLSEFVSGDRVKILPKCNHGFHVKCIDKWLGDHSS
CPTCRHCLIETCRKIVAGQDSSSSTPSPAAGGVVIGMPPMEAEGPVREHRIFKSMFFWRKN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G49230 RING/U-box superfamily protein... Lus10005818 0 1
AT3G45230 hydroxyproline-rich glycoprote... Lus10022582 1.0 0.9610
AT1G28280 VQ motif-containing protein (.... Lus10041929 1.4 0.9527
AT2G37730 Protein of unknown function (D... Lus10010869 1.7 0.9481
AT5G03170 ATFLA11, FLA11,... ARABIDOPSIS FASCICLIN-LIKE ARA... Lus10036113 4.9 0.9388
AT1G48480 RKL1 receptor-like kinase 1 (.1) Lus10031350 4.9 0.9157
AT3G27470 Protein of unknown function (D... Lus10032090 5.0 0.9379
AT1G34420 leucine-rich repeat transmembr... Lus10006067 5.7 0.8769
AT4G36870 HD BLH2, SAW1 SAWTOOTH 1, BEL1-like homeodom... Lus10016790 6.3 0.9239
AT5G03170 ATFLA11, FLA11,... ARABIDOPSIS FASCICLIN-LIKE ARA... Lus10036114 6.6 0.9220
AT5G37660 PDLP7 plasmodesmata-located protein ... Lus10020814 6.9 0.9265

Lus10005818 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.