Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000286 [exp] 53 / 7e-10 AT1G16390 334 / 4e-112 organic cation/carnitine transporter 3 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005825 pacid=23180243 polypeptide=Lus10005825 locus=Lus10005825.g ID=Lus10005825.BGIv1.0 annot-version=v1.0 ATGACGAGGCAGGCGCTGGTGCTAGGTGGCGCATTTGGTCTATTGGTGGTTGCACTTGGTCGAGAGAGTGGAGGTGCGTTGTCGTACAGAGTGTTTGGAG TTGTTATTGGAGTGTGTGCCATTGCGGTGGTTCCGTGGCCGGAGACACGGGTAAAGCCGATTAGCGATACAATGGAGGAGGAGGAGTTTAAAGCAAATTA G
AA sequence Show only first row Show all	>Lus10005825 pacid=23180243 polypeptide=Lus10005825 locus=Lus10005825.g ID=Lus10005825.BGIv1.0 annot-version=v1.0 MTRQALVLGGAFGLLVVALGRESGGALSYRVFGVVIGVCAIAVVPWPETRVKPISDTMEEEEFKAN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G16390		3-Oct, ATOCT3	organic cation/carnitine trans...		Lus10005825 [exp]	0	1
AT1G70840		MLP31	MLP-like protein 31 (.1)		Lus10020497 [exp]	5.5	0.9532
AT3G22490			Seed maturation protein (.1)		Lus10022058 [exp]	8.4	0.9502
AT1G11310		PMR2, ATMLO2, M...	POWDERY MILDEW RESISTANT 2, MI...		Lus10011630 [exp]	8.5	0.9309
AT4G27300			S-locus lectin protein kinase ...		Lus10038555 [exp]	11.8	0.8950
AT3G53980			Bifunctional inhibitor/lipid-t...		Lus10040249 [exp]	11.8	0.9300
					Lus10023665 [exp]	14.3	0.9013
AT4G39150			DNAJ heat shock N-terminal dom...		Lus10017980 [exp]	14.7	0.9377
AT2G36020		HVA22J	HVA22-like protein J (.1)		Lus10021299 [exp]	15.3	0.9404
AT1G14160			Uncharacterised protein family...		Lus10037160 [exp]	16.7	0.9483
AT1G60790		TBL2	TRICHOME BIREFRINGENCE-LIKE 2,...		Lus10030590 [exp]	17.7	0.9285

Compare expression of checked genes

Lus10005825 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.