Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 95 / 3e-23 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT4G16890 90 / 2e-21 BAL, SNC1 SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1, BALL, disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G72900 87 / 1e-20 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT5G49140 85 / 1e-19 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G11170 85 / 1e-19 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G17680 83 / 4e-19 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G41540 82 / 8e-19 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G16990 82 / 1e-18 RLM3 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative AT1G72920 79 / 2e-18 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72930 76 / 3e-18 TIR toll/interleukin-1 receptor-like (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006929 [exp] 150 / 5e-46 AT1G72890 146 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Lus10006928 [exp] 154 / 8e-45 AT5G36930 165 / 5e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10014671 [exp] 146 / 4e-44 AT5G36930 144 / 4e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10042020 [exp] 132 / 4e-37 AT1G72890 147 / 3e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Lus10026011 [exp] 118 / 3e-31 AT1G27170 423 / 5e-127 transmembrane receptors;ATP binding (.1.2) Lus10001040 [exp] 110 / 2e-30 AT5G36930 167 / 2e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10008415 [exp] 106 / 2e-29 AT5G36930 137 / 5e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10035674 [exp] 112 / 5e-29 AT5G36930 410 / 1e-121 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10008027 [exp] 108 / 5e-29 AT5G36930 197 / 5e-57 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G017082 [exp] 115 / 2e-30 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002568 [exp] 113 / 6e-30 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019053 [exp] 113 / 1e-29 AT5G36930 655 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002200 [exp] 112 / 2e-29 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G016425 [exp] 112 / 3e-29 AT5G36930 650 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G096849 [exp] 105 / 5e-29 AT5G36930 167 / 4e-48 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T011750 [exp] 111 / 7e-29 AT5G36930 551 / 2e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G143300 [exp] 110 / 9e-29 AT5G36930 519 / 2e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G142600 [exp] 110 / 1e-28 AT5G36930 535 / 5e-173 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.017G105501 [exp] 103 / 1e-28 AT5G36930 158 / 4e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10005827 pacid=23180252 polypeptide=Lus10005827 locus=Lus10005827.g ID=Lus10005827.BGIv1.0 annot-version=v1.0 ATGACTACAAACACAGGTGTACTCGACCCGAATGTCCCGACATCATTGCCTCCGACTTCGAGAAGTAGTACTACAAAGTACGATGTGTTCCTCAACTTCA GATGGGAAGACGTCCGAGGAAAGTTCGTTGACCATCTCTTCGCGAGGCTTCGAGCTTTGGAGGTCAGCGTTGTCATGGACGAGAAACATCTGGCGAAGGG CCAGATCATCCAGGCATCCATCGTGCCAGCGATCCAAAACTCGAGAGTCTACCTTACTATATTTTCGTCTGGATACGCGGACTCGAAATGGTATCTGGAT GAGTTGGTTGAGATCTTTGAATGTGTTTATCAGAATAAGGGACACATTGTCATGCCTGTCTTCTTCCTTTTGTCATCGGATGACGTGGTTACCCAGATGG GAGCTCACAAGGTTGCTTTTGCCTTCCATGAGAGTGTGTTTGCGAAGAAGAGGGTCCTGTGTTGA
AA sequence Show only first row Show all	>Lus10005827 pacid=23180252 polypeptide=Lus10005827 locus=Lus10005827.g ID=Lus10005827.BGIv1.0 annot-version=v1.0 MTTNTGVLDPNVPTSLPPTSRSSTTKYDVFLNFRWEDVRGKFVDHLFARLRALEVSVVMDEKHLAKGQIIQASIVPAIQNSRVYLTIFSSGYADSKWYLD ELVEIFECVYQNKGHIVMPVFFLLSSDDVVTQMGAHKVAFAFHESVFAKKRVLC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G36930			Disease resistance protein (TI...		Lus10005827 [exp]	0	1
AT4G26830			O-Glycosyl hydrolases family 1...		Lus10011852 [exp]	2.8	0.7574
AT1G78580		ATTPS1	TREHALOSE-6-PHOSPHATE SYNTHASE...		Lus10015243 [exp]	3.0	0.7905
					Lus10013299 [exp]	3.5	0.7442
AT3G12910	NAC		NAC (No Apical Meristem) domai...		Lus10015743 [exp]	6.0	0.7839
AT1G54830	CCAAT	NF-YC3	"nuclear factor Y, subunit C3"...		Lus10008013 [exp]	6.1	0.6024
					Lus10038003 [exp]	6.2	0.7775
					Lus10025017 [exp]	8.8	0.7441
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10006697 [exp]	11.0	0.7505
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10024706 [exp]	23.1	0.7040
AT3G02100			UDP-Glycosyltransferase superf...		Lus10003456 [exp]	25.1	0.7110

Compare expression of checked genes

Lus10005827 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.