Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41550 40 / 0.0001 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G41540 40 / 0.0001 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72840 39 / 0.0003 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006928 [exp] 86 / 9e-21 AT5G36930 165 / 5e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10042020 [exp] 69 / 1e-14 AT1G72890 147 / 3e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Lus10018024 [exp] 60 / 2e-11 AT5G18350 108 / 2e-24 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10019142 [exp] 60 / 2e-11 AT1G72890 140 / 1e-36 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Lus10011104 [exp] 43 / 2e-05 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10041060 [exp] 40 / 0.0002 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10014672 [exp] 0 / 1 AT4G02790 414 / 8e-142 EMBRYO DEFECTIVE 3129, GTP-binding family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G001600 [exp] 44 / 4e-06 AT5G36930 721 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G001602 [exp] 44 / 4e-06 AT5G36930 778 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G069200 [exp] 43 / 1e-05 AT5G17680 590 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.012G135700 [exp] 40 / 0.0001 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.001G307300 [exp] 40 / 0.0001 AT5G17680 597 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G002500 [exp] 39 / 0.0004 AT5G17680 587 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G037599 [exp] 39 / 0.0004 AT5G36930 627 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005828 pacid=23180249 polypeptide=Lus10005828 locus=Lus10005828.g ID=Lus10005828.BGIv1.0 annot-version=v1.0 ATGATGAACCGGGAAAAATCAAACCCAACTTACTCTGACCCAACCCAGCCACGTACTGAACTCAAATGGAACCGGAAAATTTGGGACAGTGATGGAGATA TCAACACCGTGAGAACAAGTGTAGGCAACAAGAAGAAGGTCCTAGCCATCGTGGACAACGTGGAAAAGCTAGAAGCTCTCCTACTGGTTGGGGTGATGTT GGATTGGTTCCGTTCGGGTAGCCGAATAGTCCTCTCGACCGTTGATGTTTCTAAAAAGGTTCTCAAAGTGGAAAAGGTTGAGACCGGAGAGTTAGTGAAG AGGGTACTGAAAGCACTGGCTACTGTAAAACCTTAA
AA sequence Show only first row Show all	>Lus10005828 pacid=23180249 polypeptide=Lus10005828 locus=Lus10005828.g ID=Lus10005828.BGIv1.0 annot-version=v1.0 MMNREKSNPTYSDPTQPRTELKWNRKIWDSDGDINTVRTSVGNKKKVLAIVDNVEKLEALLLVGVMLDWFRSGSRIVLSTVDVSKKVLKVEKVETGELVK RVLKALATVKP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10005828 [exp]	0	1
AT3G18080		BGLU44	B-S glucosidase 44 (.1)		Lus10041993 [exp]	2.4	0.7702
AT1G79460		ATKS1, ATKS, GA...	GA REQUIRING 2, ARABIDOPSIS TH...		Lus10034232 [exp]	3.5	0.7545
AT1G26380			FAD-binding Berberine family p...		Lus10021289 [exp]	7.3	0.7674
AT5G14380		AGP6	arabinogalactan protein 6 (.1)		Lus10022309 [exp]	8.1	0.6853
AT1G18010			Major facilitator superfamily ...		Lus10009413 [exp]	10.5	0.7332
AT2G45120	C2H2ZnF		C2H2-like zinc finger protein ...		Lus10031061 [exp]	11.3	0.7443
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10032259 [exp]	14.0	0.6416
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10013919 [exp]	15.2	0.6831
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10013920 [exp]	16.5	0.6796
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10015241 [exp]	17.5	0.6796

Compare expression of checked genes

Lus10005828 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.