Lus10005830 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002009 86 / 9e-22 ND /
Lus10010048 75 / 5e-19 ND /
Lus10033157 55 / 2e-10 ND /
Lus10032723 56 / 3e-10 ND /
Lus10040010 40 / 8e-05 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10005830 pacid=23180253 polypeptide=Lus10005830 locus=Lus10005830.g ID=Lus10005830.BGIv1.0 annot-version=v1.0
ATGTCCACCCTTTTGCTCTACTCGTCTGATGAGCTATGCTATTTTCTCTTAACTACAAAGTTGTCAGGTATAATTCAGCTCCTGCTTCACCATGATGGTA
AGATGATAATTAACAATTGCGGCCCTGAATATATTGGTAGAGATGTGTTTGAGGTTACATTGGACAAAGACTACCTCAGCTACTTCGAGTTGAGGAAGAT
TGTAACTTATGACATGAAGTACGCTACCGTGGAGAAGATGTTCTACCTCATCCCAGGACGGTCCATGGTTGGTGGTCTTTGA
AA sequence
>Lus10005830 pacid=23180253 polypeptide=Lus10005830 locus=Lus10005830.g ID=Lus10005830.BGIv1.0 annot-version=v1.0
MSTLLLYSSDELCYFLLTTKLSGIIQLLLHHDGKMIINNCGPEYIGRDVFEVTLDKDYLSYFELRKIVTYDMKYATVEKMFYLIPGRSMVGGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10005830 0 1
AT1G04645 Plant self-incompatibility pro... Lus10002219 1.0 1.0000
Lus10009618 2.0 1.0000
AT1G75790 SKS18 SKU5 similar 18 (.1) Lus10013556 2.8 1.0000
AT4G03220 Protein with RNI-like/FBD-like... Lus10023567 3.0 1.0000
AT5G59810 ATSBT5.4 Subtilase family protein (.1) Lus10039085 3.2 1.0000
AT3G47570 Leucine-rich repeat protein ki... Lus10035724 3.6 0.9973
AT2G03220 ATFUT1, ATFT1, ... MURUS 2, ARABIDOPSIS THALIANA ... Lus10024077 4.2 1.0000
Lus10018225 4.2 0.9993
AT5G59810 ATSBT5.4 Subtilase family protein (.1) Lus10028844 4.6 0.9998
AT1G79460 ATKS1, ATKS, GA... GA REQUIRING 2, ARABIDOPSIS TH... Lus10020865 4.7 0.9879

Lus10005830 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.