Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G26540 145 / 6e-42 Leucine-rich repeat receptor-like protein kinase family protein (.1) AT5G56040 145 / 9e-42 Leucine-rich receptor-like protein kinase family protein (.1.2) AT3G24240 100 / 7e-26 Leucine-rich repeat receptor-like protein kinase family protein (.1) AT1G34110 89 / 6e-22 Leucine-rich receptor-like protein kinase family protein (.1) AT1G28440 86 / 6e-21 HSL1 HAESA-like 1 (.1) AT5G48940 84 / 2e-20 Leucine-rich repeat transmembrane protein kinase family protein (.1) AT5G65700 84 / 3e-20 BAM1 BARELY ANY MERISTEM 1, Leucine-rich receptor-like protein kinase family protein (.1.2) AT3G49670 81 / 4e-19 BAM2 BARELY ANY MERISTEM 2, Leucine-rich receptor-like protein kinase family protein (.1) AT1G75820 77 / 7e-18 ATCLV1, FLO5, FAS3, CLV1 FLOWER DEVELOPMENT 5, FASCIATA 3, CLAVATA 1, Leucine-rich receptor-like protein kinase family protein (.1) AT5G65710 76 / 3e-17 HSL2 HAESA-like 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032954 [exp] 180 / 6e-54 AT5G56040 1399 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1.2) Lus10042090 [exp] 115 / 7e-32 AT5G56040 378 / 2e-121 Leucine-rich receptor-like protein kinase family protein (.1.2) Lus10011756 [exp] 95 / 6e-24 AT3G24240 1455 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1) Lus10017782 [exp] 86 / 8e-21 AT1G34110 1467 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Lus10000509 [exp] 85 / 1e-20 AT1G34110 1464 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Lus10018911 [exp] 85 / 2e-20 AT3G24240 1033 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1) Lus10028612 [exp] 84 / 2e-20 AT5G48940 1051 / 0.0 Leucine-rich repeat transmembrane protein kinase family protein (.1) Lus10011576 [exp] 82 / 2e-19 AT5G65700 1330 / 0.0 BARELY ANY MERISTEM 1, Leucine-rich receptor-like protein kinase family protein (.1.2) Lus10019248 [exp] 82 / 2e-19 AT5G65700 1479 / 0.0 BARELY ANY MERISTEM 1, Leucine-rich receptor-like protein kinase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G467300 [exp] 148 / 6e-43 AT4G26540 1347 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1) Potri.011G164800 [exp] 139 / 9e-40 AT5G56040 1435 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1.2) Potri.012G088100 [exp] 100 / 3e-26 AT5G56040 1005 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1.2) Potri.015G080800 [exp] 100 / 9e-26 AT5G56040 1019 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1.2) Potri.003G175700 [exp] 98 / 4e-25 AT3G24240 1374 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1) Potri.001G052500 [exp] 98 / 4e-25 AT3G24240 1367 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1) Potri.005G198000 [exp] 92 / 6e-23 AT1G34110 1381 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Potri.002G063300 [exp] 89 / 4e-22 AT1G34110 1400 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Potri.005G241500 [exp] 84 / 2e-20 AT1G75820 1268 / 0.0 FLOWER DEVELOPMENT 5, FASCIATA 3, CLAVATA 1, Leucine-rich receptor-like protein kinase family protein (.1) Potri.005G188700 [exp] 83 / 5e-20 AT5G48940 1011 / 0.0 Leucine-rich repeat transmembrane protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10005848 pacid=23160117 polypeptide=Lus10005848 locus=Lus10005848.g ID=Lus10005848.BGIv1.0 annot-version=v1.0 ATGACACTGTGCCAGAAGATGGAGCTGTCCATTGACGAGATTGTGAAGAACCTGATATCAGCAAATGTGATTGGGAACGGAAGCTCGGGAGTAGTGTACA GAGTGATTACTTCCAATGGGGAGACTACTCTGGCGGTGAAGAAAATGTGGTCAGGTGACGAATCAGAAGCATTCAATTCCAAAATAAGGACACTCGGATC GATCAGGCACAGGAACATTGTACCGTTGCTTGGTTGGGGATCCAATAATAGGAATGTCAAACTGTTGTTCTATGATTACCTTCCCAACGGAAGTTTGAAC TAA
AA sequence Show only first row Show all	>Lus10005848 pacid=23160117 polypeptide=Lus10005848 locus=Lus10005848.g ID=Lus10005848.BGIv1.0 annot-version=v1.0 MTLCQKMELSIDEIVKNLISANVIGNGSSGVVYRVITSNGETTLAVKKMWSGDESEAFNSKIRTLGSIRHRNIVPLLGWGSNNRNVKLLFYDYLPNGSLN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G26540			Leucine-rich repeat receptor-l...		Lus10005848 [exp]	0	1
AT5G56040			Leucine-rich receptor-like pro...		Lus10005847 [exp]	1.0	0.8630
AT5G15240			Transmembrane amino acid trans...		Lus10005239 [exp]	3.2	0.8204
AT4G13990			Exostosin family protein (.1)		Lus10001028 [exp]	6.9	0.7271
AT1G34770			unknown protein		Lus10033452 [exp]	10.1	0.7636
AT1G08780		PFD4, PDF4, AIP...	PREFOLDIN 4, ABI3-interacting ...		Lus10042533 [exp]	10.1	0.8024
AT2G26390			Serine protease inhibitor (SER...		Lus10005087 [exp]	12.2	0.7855
AT5G62140			unknown protein		Lus10038887 [exp]	21.4	0.7795
AT2G37670			Transducin/WD40 repeat-like su...		Lus10003974 [exp]	24.9	0.7520
					Lus10006286 [exp]	25.7	0.7568
AT4G36850			PQ-loop repeat family protein ...		Lus10016795 [exp]	28.1	0.7299

Compare expression of checked genes

Lus10005848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.