Lus10005862 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G58800 290 / 4e-101 Quinone reductase family protein (.1.2)
AT5G54500 273 / 2e-94 FQR1 flavodoxin-like quinone reductase 1 (.1.2)
AT4G27270 271 / 9e-94 Quinone reductase family protein (.1)
AT4G36750 247 / 4e-83 Quinone reductase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018401 249 / 5e-85 AT4G27270 342 / 3e-121 Quinone reductase family protein (.1)
Lus10006748 249 / 6e-85 AT4G27270 323 / 5e-114 Quinone reductase family protein (.1)
Lus10007612 249 / 2e-84 AT4G27270 329 / 1e-115 Quinone reductase family protein (.1)
Lus10020076 246 / 6e-84 AT4G27270 314 / 2e-110 Quinone reductase family protein (.1)
Lus10041718 248 / 2e-83 AT4G36750 357 / 3e-125 Quinone reductase family protein (.1)
Lus10026035 245 / 1e-82 AT4G36750 371 / 4e-131 Quinone reductase family protein (.1)
Lus10014325 245 / 2e-82 AT4G36750 370 / 2e-130 Quinone reductase family protein (.1)
Lus10040486 223 / 3e-74 AT4G36750 291 / 6e-100 Quinone reductase family protein (.1)
Lus10024032 184 / 5e-60 AT4G36750 248 / 5e-84 Quinone reductase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G044400 308 / 1e-108 AT5G58800 322 / 3e-113 Quinone reductase family protein (.1.2)
Potri.001G410700 273 / 2e-94 AT4G27270 345 / 1e-122 Quinone reductase family protein (.1)
Potri.011G129400 266 / 1e-91 AT4G27270 342 / 2e-121 Quinone reductase family protein (.1)
Potri.011G033100 259 / 4e-89 AT4G27270 352 / 1e-125 Quinone reductase family protein (.1)
Potri.004G028900 254 / 4e-87 AT4G27270 352 / 2e-125 Quinone reductase family protein (.1)
Potri.004G151100 245 / 1e-82 AT4G36750 311 / 4e-107 Quinone reductase family protein (.1)
Potri.005G126200 236 / 4e-79 AT4G36750 361 / 4e-127 Quinone reductase family protein (.1)
Potri.007G029600 234 / 2e-78 AT4G36750 362 / 3e-127 Quinone reductase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0042 Flavoprotein PF03358 FMN_red NADPH-dependent FMN reductase
Representative CDS sequence
>Lus10005862 pacid=23176920 polypeptide=Lus10005862 locus=Lus10005862.g ID=Lus10005862.BGIv1.0 annot-version=v1.0
ATGGCTCGGCAAATCCAGCGAGGAGCCAACTCCGTCCATGGCGTTGAAGCGACTCTCTGGCAGATACCGGAGACGCTCAACACAACCATACTGCAGAAGA
TGAAGGCACCCCCAAAACCAGACGACATCCCATTTATCCGAACCGACCAGCTGGTCGAAGCCGATGGGTTCCTTTTCGGTTTCCCATCACGGTTCGGAGT
CATGGCTGCTCAATGCAAGGCCTTTTTTGACGCGACAGAGGACCTCTGGAATGCCCAATCGCTCGCCGGGAAACCCGCCGGGATCTTCTGGAGCACCGGC
TTCCACGGCGGAGGCCAGGAACTCACTGCATGGACGGCGATCACGCAGTTAGCTCACCACGGGATGCTGTTTGTACCAGTTGGGTACACGTTCGGAGAGG
GGATGTTTGAGATGGATGAGGTGAAAGGTGGGTCTTCTTACGGTGCCGGAACTTTCGCTGCCGATGGGAGCCGGCAGCCAACGGAGCTTGAACTGCGGCA
GGCTTTTCACCATGGGAAGTATGTTGCTCAGATTACCAAAAAGCTCAAGAGCTAA
AA sequence
>Lus10005862 pacid=23176920 polypeptide=Lus10005862 locus=Lus10005862.g ID=Lus10005862.BGIv1.0 annot-version=v1.0
MARQIQRGANSVHGVEATLWQIPETLNTTILQKMKAPPKPDDIPFIRTDQLVEADGFLFGFPSRFGVMAAQCKAFFDATEDLWNAQSLAGKPAGIFWSTG
FHGGGQELTAWTAITQLAHHGMLFVPVGYTFGEGMFEMDEVKGGSSYGAGTFAADGSRQPTELELRQAFHHGKYVAQITKKLKS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G58800 Quinone reductase family prote... Lus10005862 0 1
AT4G32180 ATPANK2 pantothenate kinase 2 (.1.2.3) Lus10013019 4.5 0.9539
AT2G44140 Peptidase family C54 protein (... Lus10027079 7.7 0.9471
AT1G11530 ATCXXS1 C-terminal cysteine residue is... Lus10018383 8.8 0.9506
AT2G02760 ATUBC2 ubiquitin-conjugating enzyme 2... Lus10013263 9.5 0.9418
AT3G60340 alpha/beta-Hydrolases superfam... Lus10004375 10.4 0.9520
AT4G19420 Pectinacetylesterase family pr... Lus10037269 11.0 0.9379
AT5G67360 ARA12 Subtilase family protein (.1) Lus10018702 12.0 0.9469
AT3G51730 saposin B domain-containing pr... Lus10025248 12.5 0.9489
AT4G28240 Wound-responsive family protei... Lus10039758 12.7 0.9460
AT5G03455 ACR2, ARATH;CDC... ARSENATE REDUCTASE 2, Rhodanes... Lus10022616 14.4 0.9459

Lus10005862 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.