Plant FIBer expression Database

Lus10005866 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G47070 73 / 2e-18 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001204
[exp]
167 / 2e-55 AT3G47070 73 / 3e-18 unknown protein
Lus10040689
[exp]
65 / 6e-15 AT3G47070 67 / 1e-15 unknown protein
Lus10018216
[exp]
65 / 1e-14 AT3G47070 67 / 3e-15 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G043600
[exp]
86 / 2e-23 AT3G47070 68 / 2e-16 unknown protein
Potri.001G249600
[exp]
85 / 4e-23 AT3G47070 49 / 8e-09 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF11493 TSP9 Thylakoid soluble phosphoprotein TSP9
Representative CDS sequence
>Lus10005866 pacid=23176930 polypeptide=Lus10005866 locus=Lus10005866.g ID=Lus10005866.BGIv1.0 annot-version=v1.0
ATGGCTTCCTTATTGCCCATCTCCTTTAGGCCGCCGACGGTGAGAGTGTACGCAACCAAGGGATCCGCCGCAGCTGGGAAGAGCAATGAAGAGAAAGGTC
TTCTTGACTTCATTTTGGGAGGCTTGACTAAGCAGGATCAGTTCTACGAGACCGACCCCATTCTTAAGAAAGTTGAGGACACGAATGGCGGCGCCGGCAC
AGGTACAACGTCCGGTCGGAAGAACACAGTGGTTATCCCACAGACTAAGAAGAATGGTACTACTGGCTTCGGCGGCCTATTCGCCAAGAAATGA
AA sequence
>Lus10005866 pacid=23176930 polypeptide=Lus10005866 locus=Lus10005866.g ID=Lus10005866.BGIv1.0 annot-version=v1.0
MASLLPISFRPPTVRVYATKGSAAAGKSNEEKGLLDFILGGLTKQDQFYETDPILKKVEDTNGGAGTGTTSGRKNTVVIPQTKKNGTTGFGGLFAKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G47070 unknown protein Lus10005866
[exp]
0 1
AT3G54050 HCEF1 high cyclic electron flow 1 (.... Lus10027748
[exp]
1.4 0.9728
AT3G54050 HCEF1 high cyclic electron flow 1 (.... Lus10035545
[exp]
3.0 0.9661
AT3G63140 CSP41A chloroplast stem-loop binding ... Lus10014669
[exp]
3.7 0.9695
AT5G43750 PnsB5, NDH18 Photosynthetic NDH subcomplex... Lus10021890
[exp]
4.5 0.9596
AT1G73110 P-loop containing nucleoside t... Lus10041627
[exp]
4.9 0.9576
AT1G76450 Photosystem II reaction center... Lus10030719
[exp]
5.3 0.9555
AT5G36700 ATPGLP1, 2-PHOS... 2-phosphoglycolate phosphatase... Lus10026241
[exp]
5.3 0.9656
AT3G15850 JB67, FADB, ADS... FATTY ACID DESATURASE B, fatty... Lus10011488
[exp]
5.3 0.9479
AT1G09340 CSP41B, CRB, HI... heteroglycan-interacting prote... Lus10001525
[exp]
9.4 0.9532
AT1G64770 PnsB2, NDH45, N... Photosynthetic NDH subcomplex... Lus10010671
[exp]
9.9 0.9503

Lus10005866 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.