Lus10005876 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07740 258 / 1e-84 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G09900 119 / 4e-31 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G05670 118 / 1e-30 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
AT1G63070 118 / 1e-30 pentatricopeptide (PPR) repeat-containing protein (.1)
AT5G39710 117 / 3e-30 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G64320 116 / 6e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G62680 115 / 1e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G01400 114 / 1e-29 unknown protein
AT1G12775 114 / 4e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G12300 113 / 8e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040869 386 / 1e-134 AT1G07740 491 / 5e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10013283 121 / 1e-31 AT1G05670 785 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Lus10039056 120 / 3e-31 AT5G64320 832 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10027916 116 / 8e-30 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10021074 112 / 2e-29 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10012068 115 / 3e-29 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027914 113 / 9e-29 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10005303 113 / 1e-28 AT1G30290 1037 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10002675 112 / 2e-28 AT4G01400 570 / 0.0 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G204100 295 / 3e-99 AT1G07740 502 / 2e-176 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G020501 168 / 3e-53 AT1G07740 218 / 4e-70 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G014500 134 / 3e-36 AT1G09820 696 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.013G034200 122 / 3e-32 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G032600 119 / 5e-31 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G046200 117 / 3e-30 AT1G12700 501 / 5e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.001G075900 117 / 4e-30 AT4G20090 806 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G050400 115 / 7e-30 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.014G090400 115 / 1e-29 AT5G28460 637 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G109500 114 / 3e-29 AT1G09900 855 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10005876 pacid=23176947 polypeptide=Lus10005876 locus=Lus10005876.g ID=Lus10005876.BGIv1.0 annot-version=v1.0
ATGATTTCGAAAGGGAAGCGACCGAACGAGGTGACTTATGCGTTGTTAATGGAAGGATTATGCTCCATGGGAGAGCATAAGGAGGCTAAGAAGTTGATGT
TCGACATGGAATATCGAGGGTGCAAGCCGAAAGTTTTGAACTTTGGGATCTTGATGAGCGATCTAGGGAAGCGAGGCAAGATCGAGGAAGCGAAGGCTTT
GCTTGTCGAAATGAAGAAGAAGAGGAAGTTGAAGCCGGATGTTGTAACTTATAATATACTGGTGAATTGTTTGTGTAAAGAAGGGAGGGTTTCGGAGGCG
TATAAGGTGTTGCTGGAGATGGAGATGGGAGGGTGCGAGGCGAATGCAGTGACGTATAGGATGCTGGTTGATGGATTTTGCAGGGAAGGGGATTTCGAAG
GTGGGTTGAGAGTGTTGACTGCGATGTTGAGTAGTAAGCATTTCCCGAGAACTGAGACGTTTGTGTGTATGGTTGGGGGATTGCTTGAATCTGGGAATGT
TGAAGGAGCTGGGTTTGTGTTGGAGGAGATGCGTAAGAGGAAATTGGCATTGGGTTGGGATGGCTGGGAGGATCTGGTGAAGGGTTCGTCTGACAGTGAC
GAAAAATTGAGGGAACTTGTGAATCGAGTGATTGAGGGATACAAATGA
AA sequence
>Lus10005876 pacid=23176947 polypeptide=Lus10005876 locus=Lus10005876.g ID=Lus10005876.BGIv1.0 annot-version=v1.0
MISKGKRPNEVTYALLMEGLCSMGEHKEAKKLMFDMEYRGCKPKVLNFGILMSDLGKRGKIEEAKALLVEMKKKRKLKPDVVTYNILVNCLCKEGRVSEA
YKVLLEMEMGGCEANAVTYRMLVDGFCREGDFEGGLRVLTAMLSSKHFPRTETFVCMVGGLLESGNVEGAGFVLEEMRKRKLALGWDGWEDLVKGSSDSD
EKLRELVNRVIEGYK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G07740 Tetratricopeptide repeat (TPR)... Lus10005876 0 1
AT4G25270 OTP70 organelle transcript processin... Lus10031134 3.7 0.7974
AT5G25752 ATRBL11 ARABIDOPSIS RHOMBOID-LIKE PROT... Lus10022131 4.2 0.7461
AT3G24080 KRR1 family protein (.1.2) Lus10028084 4.5 0.7922
AT3G14900 EMB3120 EMBRYO DEFECTIVE 3120, unknown... Lus10039570 4.6 0.7572
AT5G37820 NIP4;2, NLM5 NODULIN- 26-LIKE MAJOR INTRINS... Lus10028520 7.7 0.7281
AT5G45190 Cyclin family protein (.1.2) Lus10040640 9.0 0.7426
AT3G53540 unknown protein Lus10025295 9.2 0.7484
AT1G71080 RNA polymerase II transcriptio... Lus10042948 12.5 0.7320
AT1G74250 DNAJ heat shock N-terminal dom... Lus10017846 13.0 0.7458
AT2G38130 ATMAK3 Acyl-CoA N-acyltransferases (N... Lus10012579 13.4 0.7212

Lus10005876 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.