Lus10005877 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07740 212 / 3e-66 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G16420 98 / 3e-23 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT3G13150 96 / 1e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G14580 84 / 2e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G13160 82 / 9e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G74580 79 / 8e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G20090 79 / 1e-16 EMB1025 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G74900 77 / 6e-16 OTP43 organelle transcript processing defect 43, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G21222 75 / 3e-15 protein kinase family protein (.1)
AT1G52640 73 / 1e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040869 417 / 4e-146 AT1G07740 491 / 5e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10005989 97 / 6e-23 AT5G16420 656 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10030222 95 / 8e-23 AT5G16420 377 / 1e-128 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10026218 97 / 1e-22 AT1G53330 440 / 2e-151 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10042452 96 / 1e-22 AT1G53330 442 / 1e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10036238 91 / 1e-20 AT4G20090 832 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10021645 80 / 5e-17 AT2G37230 1041 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10005540 80 / 7e-17 AT5G18475 562 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10011566 79 / 1e-16 AT5G65820 826 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G204100 229 / 1e-72 AT1G07740 502 / 2e-176 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.011G108500 95 / 3e-22 AT1G53330 483 / 1e-168 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.014G105900 92 / 5e-21 AT4G01400 576 / 0.0 unknown protein
Potri.012G031600 87 / 2e-19 AT5G16420 707 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.004G030000 82 / 6e-18 AT3G13160 287 / 2e-94 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.011G032312 80 / 4e-17 AT3G13160 352 / 3e-119 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.011G057900 79 / 7e-17 AT5G46100 627 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.018G081700 79 / 8e-17 AT5G21222 643 / 0.0 protein kinase family protein (.1)
Potri.011G032400 79 / 9e-17 AT3G13160 343 / 4e-116 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G234500 79 / 1e-16 AT1G74580 1034 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10005877 pacid=23176902 polypeptide=Lus10005877 locus=Lus10005877.g ID=Lus10005877.BGIv1.0 annot-version=v1.0
ATGCTTCCAATTTCAAGAGCAATCAAATGGCACACCCAATCCGACTCTTCCTGTGCTGTTAGATTGTACAGAGCTTTCCATTCCCACAAACCAAAATCCA
AAACCCAAAATCCTGACAATTCACAGAGCCGGCGGCAGCGGCGACACCGGAAAAACATACCATTCGTCACCGCCGTGAAGGAAACCGGAGAACCAGAAGA
CGCATTGGCGCTCTTTAGCGAGTACACCCAAATGGGGATCAAACACGACTACCCTTCGTACTCAGCTCTCATTTACAAGCTCGCTCGCTCTCGCAACTTC
CAAGCCGTCGAGGATGTTCTCGGTCAATTGCAAGCTAGTAACATTCGATGTGGGAGTGAGAAACTCTTCATTGCTCTATTCGATCATTACGGGAAATCCG
GGTTGTCCGATAATGCAGTCAAGCTGTTCGAGAAAATGCCAAAGTTCAACTGCGAAAGAACGTCTCAGTCTTTTAACGGTCTATTGAACGTTCTTGTTGA
CAGCGACCGTTTGGAAGAAGCAAACAAGCTGTTTGAAAAGTCCAACAAGATGAGGATCCGTCTGAATTCAGTGCCGTTCAATATAATGATCAAAGGATGG
CTAGGAAAAAAAGATTGGGATCACGCACGCCAGGTGTTCGACGAAATGCTCGAGAGAAAAATCGAACCGAGCGTGGTCACTAATCGAACCGAGCGTGGTC
ACCCCCCCCAGCCTCATCGGCTATCTATCTCGAAAGGGTGA
AA sequence
>Lus10005877 pacid=23176902 polypeptide=Lus10005877 locus=Lus10005877.g ID=Lus10005877.BGIv1.0 annot-version=v1.0
MLPISRAIKWHTQSDSSCAVRLYRAFHSHKPKSKTQNPDNSQSRRQRRHRKNIPFVTAVKETGEPEDALALFSEYTQMGIKHDYPSYSALIYKLARSRNF
QAVEDVLGQLQASNIRCGSEKLFIALFDHYGKSGLSDNAVKLFEKMPKFNCERTSQSFNGLLNVLVDSDRLEEANKLFEKSNKMRIRLNSVPFNIMIKGW
LGKKDWDHARQVFDEMLERKIEPSVVTNRTERGHPPQPHRLSISKG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G07740 Tetratricopeptide repeat (TPR)... Lus10005877 0 1
AT3G29230 Tetratricopeptide repeat (TPR)... Lus10030932 2.6 0.8858
AT2G27610 Tetratricopeptide repeat (TPR)... Lus10004892 5.8 0.8257
AT2G40720 Tetratricopeptide repeat (TPR)... Lus10027366 9.2 0.8571
AT5G20060 alpha/beta-Hydrolases superfam... Lus10019438 10.5 0.8383
AT2G38560 RDO2, TFIIS REDUCED DORMANCY 2, transcript... Lus10025215 11.4 0.8677
AT5G55280 ATFTSZ1-1, CPFT... CHLOROPLAST FTSZ, ARABIDOPSIS ... Lus10016579 12.5 0.8662
AT4G05020 NDB2 NAD(P)H dehydrogenase B2 (.1),... Lus10002599 15.1 0.8512
AT3G15130 Tetratricopeptide repeat (TPR)... Lus10007683 15.6 0.7680
AT4G18750 DOT4 DEFECTIVELY ORGANIZED TRIBUTAR... Lus10023710 16.7 0.8416
AT3G24320 CHM1, ATMSH1, C... CHLOROPLAST MUTATOR, MUTL prot... Lus10014462 17.1 0.8588

Lus10005877 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.