Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02560 169 / 1e-54 HTA12 histone H2A 12 (.1.2) AT5G59870 157 / 4e-50 HTA6 histone H2A 6 (.1) AT5G27670 151 / 9e-48 HTA7 histone H2A 7 (.1) AT1G51060 136 / 5e-42 HTA10 histone H2A 10 (.1) AT1G08880 135 / 2e-41 HTA5 ,G-H2AX ,GAMMA-H2AX ,H2AXA histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) AT1G54690 135 / 3e-41 HTA3 ,G-H2AX ,GAMMA-H2AX ,H2AXB histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) AT4G27230 134 / 6e-41 HTA2 histone H2A 2 (.1.2) AT5G54640 133 / 7e-41 ATHTA1, HTA1, RAT5 RESISTANT TO AGROBACTERIUM TRANSFORMATION 5, histone H2A 1, Histone superfamily protein (.1) AT3G20670 133 / 9e-41 HTA13 histone H2A 13 (.1) AT3G54560 86 / 6e-22 HTA11 histone H2A 11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040853 [exp] 199 / 2e-66 AT5G02560 228 / 4e-78 histone H2A 12 (.1.2) Lus10005444 [exp] 178 / 5e-58 AT5G02560 234 / 2e-80 histone H2A 12 (.1.2) Lus10004945 [exp] 176 / 2e-57 AT5G02560 233 / 5e-80 histone H2A 12 (.1.2) Lus10023754 [exp] 166 / 2e-53 AT5G02560 233 / 2e-79 histone H2A 12 (.1.2) Lus10004502 [exp] 150 / 6e-47 AT5G27670 222 / 2e-75 histone H2A 7 (.1) Lus10029899 [exp] 148 / 4e-46 AT5G27670 214 / 3e-72 histone H2A 7 (.1) Lus10039691 [exp] 139 / 9e-43 AT1G54690 249 / 1e-86 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10027154 [exp] 139 / 9e-43 AT1G54690 249 / 1e-86 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10003750 [exp] 138 / 2e-42 AT1G54690 239 / 7e-83 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G082300 [exp] 178 / 3e-58 AT5G02560 143 / 2e-44 histone H2A 12 (.1.2) Potri.005G026500 [exp] 152 / 4e-48 AT5G27670 145 / 2e-45 histone H2A 7 (.1) Potri.013G018200 [exp] 152 / 6e-48 AT5G27670 160 / 4e-51 histone H2A 7 (.1) Potri.013G028900 [exp] 138 / 9e-43 AT1G54690 220 / 4e-75 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Potri.005G040800 [exp] 138 / 2e-42 AT1G54690 221 / 2e-75 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Potri.005G040700 [exp] 138 / 2e-42 AT1G08880 183 / 2e-60 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.001G415700 [exp] 138 / 2e-42 AT1G51060 174 / 1e-56 histone H2A 10 (.1) Potri.013G028800 [exp] 137 / 3e-42 AT1G08880 190 / 2e-63 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.011G131400 [exp] 136 / 5e-42 AT1G51060 200 / 1e-67 histone H2A 10 (.1) Potri.004G031300 [exp] 132 / 2e-40 AT1G08880 150 / 6e-48 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [flax] [poplar] Histone PF00125 [flax] [poplar] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Lus10005892 pacid=23176941 polypeptide=Lus10005892 locus=Lus10005892.g ID=Lus10005892.BGIv1.0 annot-version=v1.0 ATGGATTCCGCAGCCACAAAAATGAAGAAAGGAGCCGGCGGAAGGAAGGGCGGCGGTCCTAAGAAGAAGCCAGTCTCCAGATCGGTGAAAGCCGGACTTC AGTTCCCCGTCGGTAGGATCGGAAGGTACCTGAAGAAGGGAAGGTACGCTCAGCGTGTCGGCACCGGAGCTCCGGTCTACTTGGCGGCAGTCCTCGAGTA TTTGGCAGCTGAGGTTCTTGAGCTTGCTGGGAATGCTGCTCGAGACAACAAGAAGAACAGGATCATCCCCCGTCATGTTCTTCTAGCAATCAGGAATGAC GAGGAGCTCGGAAAGCTGCTTGCCGGAGTCACCATTGCTCACGGTGGAGTTCTCCCGAACATCAACCCAGTACTGCTACCGAAGAAGACTGATCGAGCTA CTAAGGAGCCCAAGGAATCCACCAAGTCTCCAGCCAAGGCCGGAAAGTCTCCCAAGAAAGCTTAG
AA sequence Show only first row Show all	>Lus10005892 pacid=23176941 polypeptide=Lus10005892 locus=Lus10005892.g ID=Lus10005892.BGIv1.0 annot-version=v1.0 MDSAATKMKKGAGGRKGGGPKKKPVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNKKNRIIPRHVLLAIRND EELGKLLAGVTIAHGGVLPNINPVLLPKKTDRATKEPKESTKSPAKAGKSPKKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02560		HTA12	histone H2A 12 (.1.2)		Lus10005892 [exp]	0	1
AT5G02560		HTA12	histone H2A 12 (.1.2)		Lus10040853 [exp]	1.0	0.9906
AT3G27360			Histone superfamily protein (....		Lus10013948 [exp]	1.4	0.9877
AT3G53730			Histone superfamily protein (....		Lus10038481 [exp]	2.4	0.9857
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Lus10021157 [exp]	3.2	0.9787
AT5G14920			Gibberellin-regulated family p...		Lus10039443 [exp]	3.5	0.9814
AT4G11080		3xHMG-box1	3xHigh Mobility Group-box1, HM...		Lus10032379 [exp]	3.7	0.9698
AT5G10400			Histone superfamily protein (....		Lus10031822 [exp]	5.5	0.9719
AT5G41685			Mitochondrial outer membrane t...		Lus10007843 [exp]	5.7	0.9628
AT5G59970			Histone superfamily protein (....		Lus10041919 [exp]	6.9	0.9582
AT1G09200			Histone superfamily protein (....		Lus10005270 [exp]	9.4	0.9677

Compare expression of checked genes

Lus10005892 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.