Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59613 96 / 4e-28 unknown protein AT3G46430 96 / 4e-28 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040848 [exp] 118 / 7e-37 AT5G59613 96 / 2e-28 unknown protein Lus10005449 [exp] 115 / 9e-36 AT3G46430 96 / 9e-29 unknown protein Lus10004950 [exp] 115 / 9e-36 AT3G46430 96 / 9e-29 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G053000 [exp] 101 / 5e-30 AT5G59613 92 / 5e-27 unknown protein Potri.010G207600 [exp] 99 / 2e-29 AT5G59613 92 / 4e-27 unknown protein Potri.010G183951 [exp] 37 / 0.0002 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005899 pacid=23176948 polypeptide=Lus10005899 locus=Lus10005899.g ID=Lus10005899.BGIv1.0 annot-version=v1.0 ATGAGGAGGTTGTTCGATCCGTGGCCAGTGTTCTTCAAGCGGGAATGGAATCGCAACTGGCCGTTCCTTGTTGGCTTCGCTGTGACCGGAACCATCATCA CCAAGATGTCTCTCGGCCTCACTGAGGAGGAAGCCAAGAACTCGAAGTTTGTCCAGAGGCACAAGAAGAGATCGAAGCTCTGCTTGATTGATCAGTTGAT ACCTTTTGAGTTTGAATTGGAGATGATACTTAGATTCTTAGGCAATGAAGAGAGTGATGCTTAG
AA sequence Show only first row Show all	>Lus10005899 pacid=23176948 polypeptide=Lus10005899 locus=Lus10005899.g ID=Lus10005899.BGIv1.0 annot-version=v1.0 MRRLFDPWPVFFKREWNRNWPFLVGFAVTGTIITKMSLGLTEEEAKNSKFVQRHKKRSKLCLIDQLIPFEFELEMILRFLGNEESDA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59613			unknown protein		Lus10005899 [exp]	0	1
					Lus10027730 [exp]	1.4	0.9570
AT5G03700			D-mannose binding lectin prote...		Lus10023868 [exp]	3.9	0.9466
AT5G49510		PFD3, PDF3	prefoldin 3 (.1.2)		Lus10017066 [exp]	5.3	0.9449
AT4G10100		CNX7, SIR5	"co-factor for nitrate, reduct...		Lus10030343 [exp]	6.6	0.9167
AT3G11470			4'-phosphopantetheinyl transfe...		Lus10017021 [exp]	6.8	0.9262
AT4G05390		ATRFNR1	root FNR 1 (.1.2)		Lus10023266 [exp]	6.8	0.9500
AT4G34270			TIP41-like family protein (.1)		Lus10020231 [exp]	6.9	0.9133
AT5G47870		RAD52-2B, RAD52...	radiation sensitive 51-2, unkn...		Lus10002565 [exp]	7.7	0.9345
AT1G26750			unknown protein		Lus10019740 [exp]	8.0	0.9230
AT3G12160		AtRABA4d	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10021023 [exp]	8.7	0.9438

Compare expression of checked genes

Lus10005899 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.