Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005901 pacid=23176945 polypeptide=Lus10005901 locus=Lus10005901.g ID=Lus10005901.BGIv1.0 annot-version=v1.0 ATGAGAAACAGAGTTTTCTTCTTCTCCGTCATCATAGCCGCCGTTATAGCTCTCTCATCATCACCCTCTCCGGTTGTGGCCGTTGCCAGACAGTTGTTAC CTGCAGAAGCTGAGGAGACCAGCAAAAGGGGCGACGTCGTCGAAATAGACGGTTTAGAAAAGAGAGGGGACAAGAAACGAAGTAGTTCCTTACCGCGGGG ATCGGCTGCGGCTCCCGACTCCAACTCTGACTACTACTATGAGCCGCCGGCAGACCAGCCCAGTACTAGTACCTCTGATAATTCTTCATTTCCGGTTTCT ATAGAATCTCCTCCTCCTGGGCCATTTGCTTGA
AA sequence Show only first row Show all	>Lus10005901 pacid=23176945 polypeptide=Lus10005901 locus=Lus10005901.g ID=Lus10005901.BGIv1.0 annot-version=v1.0 MRNRVFFFSVIIAAVIALSSSPSPVVAVARQLLPAEAEETSKRGDVVEIDGLEKRGDKKRSSSLPRGSAAAPDSNSDYYYEPPADQPSTSTSDNSSFPVS IESPPPGPFA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10005901 [exp]	0	1
AT5G50790		SWEET10, AtSWEE...	Nodulin MtN3 family protein (....		Lus10008861 [exp]	2.4	0.9237
AT3G49220			Plant invertase/pectin methyle...		Lus10018103 [exp]	2.8	0.8750
AT1G74250			DNAJ heat shock N-terminal dom...		Lus10012524 [exp]	2.8	0.8863
AT1G74250			DNAJ heat shock N-terminal dom...		Lus10022344 [exp]	3.2	0.8849
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Lus10006825 [exp]	5.5	0.8809
AT5G26170	WRKY	ATWRKY50, WRKY5...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10006848 [exp]	5.7	0.8889
AT1G06460		ACD31.2, ACD32....	ALPHA-CRYSTALLIN DOMAIN 31.2, ...		Lus10020785 [exp]	6.3	0.8955
AT5G40010		ASD, AATP1	ATPase-in-Seed-Development, AA...		Lus10042166 [exp]	6.7	0.8500
AT5G23940		PEL3, DCR, EMB3...	PERMEABLE LEAVES3, EMBRYO DEFE...		Lus10027500 [exp]	7.3	0.8749
AT1G11600		CYP77B1	"cytochrome P450, family 77, s...		Lus10007659 [exp]	10.5	0.8730

Compare expression of checked genes

Lus10005901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.