Lus10005902 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040846 96 / 5e-24 AT2G28780 680 / 0.0 unknown protein
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10005902 pacid=23176950 polypeptide=Lus10005902 locus=Lus10005902.g ID=Lus10005902.BGIv1.0 annot-version=v1.0
ATGATGATGAGAAACAGAGGCTCAGCTTTCTCCTCTGGCTTACTGCTGCTCTTCATCATCATAGCAGCCGCCGCCACTATAGCTCTCTCAGTGCCCTCTG
CTCCGGTGAGGATCCGCCACCTGGCCGCTGCCAGAGTGTTGCTGCCAGAAGCTGATCAGCAAGAGATAGGGACCGACGACGTCGTATACACGAGGATTGG
ATGGAAGAGACGAAGTAGATCCCCGGGATGGGGATCTGCTACGGTGGTCGAGTCTGTTCCTGCGTCCAACAAGGACGAAATAGACTCTTCTCCGGTCTCT
ACGACCGCAACAACATCTCCTCCTCCTGGGTCGTTCGTTTAA
AA sequence
>Lus10005902 pacid=23176950 polypeptide=Lus10005902 locus=Lus10005902.g ID=Lus10005902.BGIv1.0 annot-version=v1.0
MMMRNRGSAFSSGLLLLFIIIAAAATIALSVPSAPVRIRHLAAARVLLPEADQQEIGTDDVVYTRIGWKRRSRSPGWGSATVVESVPASNKDEIDSSPVS
TTATTSPPPGSFV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10005902 0 1
AT5G22860 Serine carboxypeptidase S28 fa... Lus10005354 6.2 0.8225
AT3G12340 FKBP-like peptidyl-prolyl cis-... Lus10011649 8.0 0.7092
AT3G47570 Leucine-rich repeat protein ki... Lus10016896 8.0 0.8200
Lus10021407 10.4 0.8121
Lus10021406 13.6 0.8114
AT2G47190 MYB AtMYB2 myb domain protein 2 (.1) Lus10009996 15.8 0.7989
AT3G60290 2-oxoglutarate (2OG) and Fe(II... Lus10018950 16.1 0.7984
AT1G16130 WAKL2 wall associated kinase-like 2 ... Lus10004504 18.1 0.7971
AT5G05340 Peroxidase superfamily protein... Lus10032786 19.2 0.7885
AT3G49780 ATPSK3(FORMERSY... phytosulfokine 4 precursor (.1... Lus10011721 19.5 0.7798

Lus10005902 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.