Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13180 91 / 3e-24 NAC VNDIP2, ANAC083, VNI2 VND-interacting 2, NAC domain containing protein 83 (.1) AT2G33480 88 / 4e-23 NAC ANAC041 NAC domain containing protein 41 (.1.2) AT1G61110 67 / 3e-15 NAC ANAC025 NAC domain containing protein 25 (.1) AT3G04070 65 / 3e-14 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT1G69490 62 / 2e-13 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT3G15510 61 / 9e-13 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT1G77450 58 / 4e-12 NAC ANAC032 NAC domain containing protein 32 (.1) AT1G52880 57 / 2e-11 NAC ATNAM, NAM, ANAC018, NARS2 NAC-REGULATED SEED MORPHOLOGY 2, Arabidopsis NAC domain containing protein 18, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G65910 56 / 3e-11 NAC ANAC028 NAC domain containing protein 28 (.1) AT1G54330 56 / 4e-11 NAC ANAC020 NAC domain containing protein 20 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002581 [exp] 100 / 3e-28 AT5G13180 273 / 6e-93 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10001809 [exp] 100 / 5e-28 AT5G13180 271 / 6e-92 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10026496 [exp] 66 / 2e-14 AT1G61110 244 / 6e-79 NAC domain containing protein 25 (.1) Lus10032004 [exp] 65 / 2e-14 AT5G14000 113 / 2e-30 NAC domain containing protein 84 (.1) Lus10036773 [exp] 65 / 2e-14 AT1G69490 318 / 1e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10037156 [exp] 65 / 2e-14 AT1G69490 318 / 2e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10011215 [exp] 65 / 3e-14 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1) Lus10023179 [exp] 64 / 4e-14 AT1G61110 248 / 2e-80 NAC domain containing protein 25 (.1) Lus10043095 [exp] 64 / 4e-14 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G061200 [exp] 94 / 2e-25 AT5G13180 310 / 6e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.003G166500 [exp] 91 / 3e-24 AT5G13180 310 / 4e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.015G102100 [exp] 86 / 2e-22 AT5G13180 232 / 8e-77 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.012G103500 [exp] 81 / 9e-21 AT5G13180 229 / 2e-75 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.001G325100 [exp] 75 / 2e-18 AT5G13180 163 / 2e-49 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.017G063300 [exp] 72 / 2e-17 AT5G13180 150 / 9e-45 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.011G046700 [exp] 67 / 5e-15 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.008G089000 [exp] 66 / 6e-15 AT1G69490 331 / 6e-115 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.010G166200 [exp] 64 / 4e-14 AT1G69490 305 / 1e-104 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.001G404400 [exp] 64 / 5e-14 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10005917 pacid=23140127 polypeptide=Lus10005917 locus=Lus10005917.g ID=Lus10005917.BGIv1.0 annot-version=v1.0 ATGGAGAAGATGAGTTGTGTCAAGAAAGGAGTGTTGAGACTGCCACCTAGCTTCAGATTCCACCCAACCAACGAGGAGCTCGTGGTTCAATACCTCAAAC GGAAAGTCTGTTCCTTTCCTTTGCCCGCTTCAATCATTCCTGAAGTCAATATCAGCAAGTCTGATCCTTGA
AA sequence Show only first row Show all	>Lus10005917 pacid=23140127 polypeptide=Lus10005917 locus=Lus10005917.g ID=Lus10005917.BGIv1.0 annot-version=v1.0 MEKMSCVKKGVLRLPPSFRFHPTNEELVVQYLKRKVCSFPLPASIIPEVNISKSDP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G13180	NAC	VNDIP2, ANAC083...	VND-interacting 2, NAC domain ...		Lus10005917 [exp]	0	1
AT1G70870			Polyketide cyclase/dehydrase a...		Lus10008931 [exp]	1.4	0.7978
AT2G46760			D-arabinono-1,4-lactone oxidas...		Lus10030206 [exp]	6.0	0.6483
					Lus10007991 [exp]	7.7	0.7745
AT2G20710			Tetratricopeptide repeat (TPR)...		Lus10016229 [exp]	8.5	0.6508
AT2G26975			Ctr copper transporter family ...		Lus10017205 [exp]	12.8	0.6850
AT1G49320		ATUSPL1	unknown seed protein like 1 (....		Lus10032324 [exp]	19.4	0.6853
					Lus10024506 [exp]	28.1	0.6041
AT2G31260		ATAPG9, APG9	autophagy 9 (APG9) (.1)		Lus10000709 [exp]	39.4	0.6493
AT5G43080		CYCA3;1	Cyclin A3;1 (.1)		Lus10026598 [exp]	68.6	0.6047
AT2G22070			pentatricopeptide (PPR) repeat...		Lus10019689 [exp]	81.9	0.5809

Compare expression of checked genes

Lus10005917 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.