Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42905 44 / 2e-06 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006008 [exp] 43 / 1e-06 AT5G42905 47 / 2e-07 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10005051 [exp] 41 / 4e-05 AT3G51780 221 / 1e-69 BCL-2-associated athanogene 4 (.1) Lus10036265 [exp] 40 / 4e-05 AT5G42905 52 / 2e-08 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10020729 [exp] 40 / 0.0001 AT5G17230 491 / 7e-174 PHYTOENE SYNTHASE (.1.2.3) Lus10034950 [exp] 37 / 0.0006 AT5G42905 42 / 4e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005922 pacid=23140129 polypeptide=Lus10005922 locus=Lus10005922.g ID=Lus10005922.BGIv1.0 annot-version=v1.0 ATGCAACCTGACAACGATGGAGCTGCTGGTGTTATTCAGAATGCTCACGGGAATTTTTTGGGAGCATTTGCTGCTAATCTCGGTGACTGTACGATGAGCG GGGCAGAATTATCAAGGGGTGATTTTGTGCTTCAGATTGCGTGGGACAAGGGGTGTAGAAAGGTTCACCTGCAGCTTGATTCGGCATGTGCTATTGCTGG GTCATTGGGTGATTTTCAGCATTTTTCTTGCATTCTTGGTGCGGGACGACTTCTCAAGAAAGATCAGAAGGTGTGA
AA sequence Show only first row Show all	>Lus10005922 pacid=23140129 polypeptide=Lus10005922 locus=Lus10005922.g ID=Lus10005922.BGIv1.0 annot-version=v1.0 MQPDNDGAAGVIQNAHGNFLGAFAANLGDCTMSGAELSRGDFVLQIAWDKGCRKVHLQLDSACAIAGSLGDFQHFSCILGAGRLLKKDQKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42905			Polynucleotidyl transferase, r...		Lus10005922 [exp]	0	1
					Lus10011588 [exp]	1.4	0.8876
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10020851 [exp]	2.4	0.8057
AT5G04480			UDP-Glycosyltransferase superf...		Lus10017452 [exp]	2.8	0.8128
					Lus10040028 [exp]	6.5	0.7715
					Lus10003223 [exp]	7.7	0.7449
AT4G24690		AtNBR1	Arabidopsis thaliana next to B...		Lus10043320 [exp]	10.0	0.6913
					Lus10024939 [exp]	11.8	0.7810
AT2G01190		PDE331	PIGMENT DEFECTIVE 331, Octicos...		Lus10007965 [exp]	16.1	0.7838
					Lus10005396 [exp]	20.9	0.7782
AT3G49060			U-box domain-containing protei...		Lus10039245 [exp]	20.9	0.7482

Compare expression of checked genes

Lus10005922 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.