Lus10005929 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G03150 165 / 3e-52 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040907 173 / 3e-55 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G135400 173 / 5e-55 AT4G03150 169 / 1e-53 unknown protein
PFAM info
Representative CDS sequence
>Lus10005929 pacid=23146040 polypeptide=Lus10005929 locus=Lus10005929.g ID=Lus10005929.BGIv1.0 annot-version=v1.0
ATGATGAACATGATCTTCTCTGCTCCGTGTCCAAAATGCGATCCAACCGCAGCAACCTTCCCTTTCGTTGTCATCTCTCGGTCCTCCACACTCCAAATCT
CGCTTAACCCACCAGCAGCAGCTAACCCAATCCGCCCTTTCAAGACTCGGCACGCTCCTCCCTCCACTGTTTCCAGATGCCATCTGAACGACGATGACGA
CGCTCAAGTGCAAGACCTCAAGGTCCCTCAGAAATGGCTGCATCCTTCCAAAGCACTGGAGGAATCGGAATGGCTCAGAGTTTCGCTGCACAAATGGCTG
GATGATGAGTACTGCCCGGAGGATACAAATGTGGAAATCAGCAGAGTCGCTGCCCGATCGTATTATGAGTCTCTGCTTGATGAACGGACCGAGCTGGGCG
AGATTCTGTTGAAGATGGCTTGCGAATTGGAAGCTATTTCCTATCAAGACAGTTTCCACGGGGCCTTCTCATCAGCTAATGCGGCAGTGAACTTGATTTC
CCAACGGATACATCATCAGGGTAATGTTATGTTGTCAACTTTCCTCAATCAATGA
AA sequence
>Lus10005929 pacid=23146040 polypeptide=Lus10005929 locus=Lus10005929.g ID=Lus10005929.BGIv1.0 annot-version=v1.0
MMNMIFSAPCPKCDPTAATFPFVVISRSSTLQISLNPPAAANPIRPFKTRHAPPSTVSRCHLNDDDDAQVQDLKVPQKWLHPSKALEESEWLRVSLHKWL
DDEYCPEDTNVEISRVAARSYYESLLDERTELGEILLKMACELEAISYQDSFHGAFSSANAAVNLISQRIHHQGNVMLSTFLNQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G03150 unknown protein Lus10005929 0 1
AT3G52750 FTSZ2-2 Tubulin/FtsZ family protein (.... Lus10021367 9.0 0.8791
AT1G02150 Tetratricopeptide repeat (TPR)... Lus10009787 9.1 0.9103
AT3G54210 Ribosomal protein L17 family p... Lus10007002 10.3 0.9099
AT5G54190 PORA protochlorophyllide oxidoreduc... Lus10039810 15.2 0.9074
AT3G14930 HEME1 Uroporphyrinogen decarboxylase... Lus10043079 20.2 0.9030
AT1G35680 RPL21C chloroplast ribosomal protein ... Lus10017912 22.2 0.8964
AT1G35680 RPL21C chloroplast ribosomal protein ... Lus10014819 24.3 0.9015
AT1G14030 Rubisco methyltransferase fami... Lus10036780 25.1 0.8936
AT4G25080 CHLM magnesium-protoporphyrin IX me... Lus10036021 29.5 0.8953
AT3G54210 Ribosomal protein L17 family p... Lus10006999 29.7 0.8951

Lus10005929 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.