Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30540 138 / 5e-44 Thioredoxin superfamily protein (.1) AT2G47880 137 / 1e-43 Glutaredoxin family protein (.1) AT1G06830 133 / 6e-42 Glutaredoxin family protein (.1) AT3G62960 131 / 4e-41 Thioredoxin superfamily protein (.1) AT3G62950 111 / 4e-33 Thioredoxin superfamily protein (.1) AT2G47870 104 / 1e-30 Thioredoxin superfamily protein (.1) AT3G21460 95 / 7e-27 Glutaredoxin family protein (.1) AT5G14070 96 / 2e-26 ROXY2 Thioredoxin superfamily protein (.1) AT4G15670 89 / 2e-24 Thioredoxin superfamily protein (.1) AT4G15660 89 / 2e-24 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040899 [exp] 210 / 2e-72 AT2G30540 140 / 5e-45 Thioredoxin superfamily protein (.1) Lus10035183 [exp] 103 / 2e-29 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1) Lus10033965 [exp] 101 / 3e-29 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1) Lus10040898 [exp] 100 / 5e-29 AT3G62950 167 / 2e-55 Thioredoxin superfamily protein (.1) Lus10012815 [exp] 100 / 8e-29 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1) Lus10005938 [exp] 100 / 8e-29 AT3G62950 166 / 3e-55 Thioredoxin superfamily protein (.1) Lus10002887 [exp] 99 / 2e-28 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1) Lus10011333 [exp] 98 / 2e-27 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1) Lus10041538 [exp] 86 / 1e-22 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G208400 [exp] 150 / 8e-49 AT2G30540 160 / 8e-53 Thioredoxin superfamily protein (.1) Potri.014G134300 [exp] 144 / 4e-46 AT2G30540 157 / 1e-51 Thioredoxin superfamily protein (.1) Potri.001G325800 [exp] 114 / 5e-34 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1) Potri.003G167000 [exp] 110 / 8e-33 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1) Potri.001G060600 [exp] 109 / 2e-32 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1) Potri.008G214500 [exp] 106 / 3e-31 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1) Potri.010G021800 [exp] 101 / 3e-29 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.008G214800 [exp] 100 / 6e-29 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1) Potri.008G214600 [exp] 100 / 1e-28 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1) Potri.002G208500 [exp] 99 / 3e-28 AT3G62950 171 / 5e-57 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00462 [flax] [poplar] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Lus10005937 pacid=23146059 polypeptide=Lus10005937 locus=Lus10005937.g ID=Lus10005937.BGIv1.0 annot-version=v1.0 ATGGAGAAGGTGATGAGTTTGGCATCGGAGAACGGGGTGGTGATCTTCGGCAAGAGCTCATGTTGCATGTGTTATGCGGTGAACATGTTGTTCCAAGGGA TAGGAGTGAAGCCGGTGGTGTACGATATCGACCAGGACCCTGAAGGCTGCAGGGACATGGAGAAGGCACTGATGAAGCTCGGAACCACCACCGGACCGGT CCCTGCTGTGTTCATCGGCGGCAAGTTCATGGGCTCCACTAATGAGATCATGTCCGCTCATCTTAGTGGCCAGCTCGTTCACATGCTCCAGCCTTACCAG TCCTTGTCTTGA
AA sequence Show only first row Show all	>Lus10005937 pacid=23146059 polypeptide=Lus10005937 locus=Lus10005937.g ID=Lus10005937.BGIv1.0 annot-version=v1.0 MEKVMSLASENGVVIFGKSSCCMCYAVNMLFQGIGVKPVVYDIDQDPEGCRDMEKALMKLGTTTGPVPAVFIGGKFMGSTNEIMSAHLSGQLVHMLQPYQ SLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G47880			Glutaredoxin family protein (....		Lus10005937 [exp]	0	1
					Lus10035963 [exp]	1.7	0.8256
AT3G18440		ATALMT9	aluminum-activated malate tran...		Lus10024711 [exp]	4.0	0.7808
AT2G25760			Protein kinase family protein ...		Lus10038275 [exp]	5.3	0.7435
AT1G05510			Protein of unknown function (D...		Lus10021483 [exp]	5.7	0.8027
AT3G05210		UVR7, ERCC1	UV REPAIR DEFICIENT 7, nucleot...		Lus10029947 [exp]	10.3	0.8135
AT1G30690			Sec14p-like phosphatidylinosit...		Lus10031752 [exp]	14.1	0.7343
AT1G53440			Leucine-rich repeat transmembr...		Lus10041937 [exp]	15.2	0.7704
AT1G11340			S-locus lectin protein kinase ...		Lus10013246 [exp]	15.5	0.7131
AT2G46760			D-arabinono-1,4-lactone oxidas...		Lus10002688 [exp]	16.8	0.7570
					Lus10028745 [exp]	26.5	0.6740

Compare expression of checked genes

Lus10005937 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.