Lus10005939 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G62940 343 / 9e-118 Cysteine proteinases superfamily protein (.1.2.3)
AT5G67170 78 / 4e-16 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
AT2G27350 70 / 4e-13 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
AT2G38025 49 / 2e-06 Cysteine proteinases superfamily protein (.1)
AT5G04250 45 / 4e-05 Cysteine proteinases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040897 532 / 0 AT3G62940 359 / 1e-124 Cysteine proteinases superfamily protein (.1.2.3)
Lus10005193 75 / 9e-15 AT2G27350 549 / 0.0 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Lus10013303 64 / 6e-11 AT2G27350 468 / 7e-162 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Lus10006255 62 / 1e-10 AT5G67170 363 / 7e-124 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Lus10010459 47 / 1e-05 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G134100 417 / 3e-147 AT3G62940 338 / 9e-116 Cysteine proteinases superfamily protein (.1.2.3)
Potri.004G196800 77 / 2e-15 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.009G160100 75 / 9e-15 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.005G140500 62 / 2e-10 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Potri.016G110400 48 / 3e-06 AT2G38025 276 / 1e-94 Cysteine proteinases superfamily protein (.1)
Potri.006G021700 46 / 1e-05 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3)
Potri.014G140200 45 / 3e-05 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1)
Potri.006G057400 44 / 7e-05 AT3G57810 308 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Potri.016G019700 40 / 0.001 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Lus10005939 pacid=23146030 polypeptide=Lus10005939 locus=Lus10005939.g ID=Lus10005939.BGIv1.0 annot-version=v1.0
ATGGCCGACACCGTTGATGCGATTGATCAACCATCTGATGATGCTGCTGCTGTTGGCGATACTGAAAAGAAGCAGGAAAATCGCGATGAGATGCTCGCCA
GGCATAGGAAGGAGACAACAGCGCTGCAGAACAAAGAAATTGAACTGAAGAAGGGGGCAGCAAAAGGGAGCAAAACGGAACAGAAAGCCAAGAAGAAGCA
AGTTGAAGAACAAATAACACGGCTTTCTACTGAGCTCAAAGAGAAGCAAGCGCAAGAGCTTGCTTCATTAGGCTATGTCAATAGCAATGACAGCGAGAAA
GGCAACCTCGATACGCTAGTGAAGGCCATAGCTGGGGTTTCTGTCAGCAGTCCCTCTGCTGATAACAGTACCAGGAGGAGCAAAGGTGGGAAAAGGAAAG
ATAAGAGAGCTCAGCAAGAAGCTGAGAGAGAGAAAAGGATCCAGGAAGAACAGAGCAACCTTGTGAGTGACAGAATGATTGAAGACGAGAAACTGGGGAG
AAAGCTCGAGCCCCTTGGGTTGACTGTTAATGAGATCAAACCGGACGGTAATTGCCTCTACCGAGCTGTGGAAGACCAGCTAGCTCTCCTTTCTGGCGGT
TCTTCCCCATATACCTACCAAGATCTCCGGGAAATGGTGGCAGCGTATATGAGAAAGAACTCGTCGGAGTTCCTGCCGTTTTTCCTTTCCGAAACAGATA
ATGCAGAAGAAGCAGAATCTGACAGTACTCTCACGGAGAGATTCGAGAGTTACTGTAAGGAAATCGAATCGACAGCTGCTTGGGGTGGACAACTGGAGCT
GGGTGCTTTAACTCACTGCTTGAGGAGGCCTATAATGATATATTCAGGATCGTTCCCTGATGTTGAGATGGGGAAGGAATACAAACCAGGCGGTGGTTCG
TCGTCTACAGCAAATATTATGCTGTCATATCATAAGCATGCATTTGGGCTTGGTGAACATTACAACTCTGTAGTTCCCAGTTTGATTAGGTAG
AA sequence
>Lus10005939 pacid=23146030 polypeptide=Lus10005939 locus=Lus10005939.g ID=Lus10005939.BGIv1.0 annot-version=v1.0
MADTVDAIDQPSDDAAAVGDTEKKQENRDEMLARHRKETTALQNKEIELKKGAAKGSKTEQKAKKKQVEEQITRLSTELKEKQAQELASLGYVNSNDSEK
GNLDTLVKAIAGVSVSSPSADNSTRRSKGGKRKDKRAQQEAEREKRIQEEQSNLVSDRMIEDEKLGRKLEPLGLTVNEIKPDGNCLYRAVEDQLALLSGG
SSPYTYQDLREMVAAYMRKNSSEFLPFFLSETDNAEEAESDSTLTERFESYCKEIESTAAWGGQLELGALTHCLRRPIMIYSGSFPDVEMGKEYKPGGGS
SSTANIMLSYHKHAFGLGEHYNSVVPSLIR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G62940 Cysteine proteinases superfami... Lus10005939 0 1
AT5G22610 F-box/RNI-like/FBD-like domain... Lus10027019 11.6 0.8401
AT3G53990 Adenine nucleotide alpha hydro... Lus10022602 17.3 0.8507
AT5G36930 Disease resistance protein (TI... Lus10006928 20.2 0.8452
AT3G61430 ATPIP1, PIP1;1,... PLASMA MEMBRANE INTRINSIC PROT... Lus10040217 22.8 0.8376
AT4G02340 alpha/beta-Hydrolases superfam... Lus10006827 24.6 0.8354
AT1G55270 Galactose oxidase/kelch repeat... Lus10030072 33.9 0.8232
AT5G20260 Exostosin family protein (.1) Lus10005186 44.0 0.8130
AT1G54310 S-adenosyl-L-methionine-depend... Lus10001763 44.2 0.7462
AT5G53070 Ribosomal protein L9/RNase H1 ... Lus10022383 47.3 0.8262
Lus10001993 48.2 0.7925

Lus10005939 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.