Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62930 129 / 5e-40 Thioredoxin superfamily protein (.1) AT1G03020 127 / 2e-39 Thioredoxin superfamily protein (.1) AT5G18600 108 / 3e-32 Thioredoxin superfamily protein (.1) AT4G15690 106 / 3e-31 Thioredoxin superfamily protein (.1) AT4G15700 105 / 1e-30 Thioredoxin superfamily protein (.1) AT4G15680 103 / 4e-30 Thioredoxin superfamily protein (.1) AT4G15660 102 / 1e-29 Thioredoxin superfamily protein (.1) AT4G15670 101 / 4e-29 Thioredoxin superfamily protein (.1) AT3G21460 83 / 5e-22 Glutaredoxin family protein (.1) AT2G47870 82 / 1e-21 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029440 [exp] 198 / 2e-67 AT3G62930 144 / 4e-46 Thioredoxin superfamily protein (.1) Lus10029441 [exp] 127 / 2e-39 AT3G62930 145 / 1e-46 Thioredoxin superfamily protein (.1) Lus10005941 [exp] 127 / 4e-39 AT3G62930 145 / 8e-47 Thioredoxin superfamily protein (.1) Lus10033965 [exp] 92 / 2e-25 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1) Lus10002887 [exp] 92 / 2e-25 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1) Lus10012815 [exp] 92 / 2e-25 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1) Lus10035183 [exp] 81 / 1e-20 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1) Lus10040898 [exp] 80 / 2e-20 AT3G62950 167 / 2e-55 Thioredoxin superfamily protein (.1) Lus10005938 [exp] 79 / 3e-20 AT3G62950 166 / 3e-55 Thioredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G134000 [exp] 148 / 1e-47 AT3G62930 158 / 8e-52 Thioredoxin superfamily protein (.1) Potri.002G208700 [exp] 141 / 5e-45 AT3G62930 157 / 1e-51 Thioredoxin superfamily protein (.1) Potri.014G133800 [exp] 115 / 8e-35 AT1G03020 142 / 1e-45 Thioredoxin superfamily protein (.1) Potri.014G133900 [exp] 114 / 3e-34 AT3G62930 141 / 4e-45 Thioredoxin superfamily protein (.1) Potri.014G133700 [exp] 114 / 4e-34 AT3G62930 143 / 7e-46 Thioredoxin superfamily protein (.1) Potri.002G209000 [exp] 113 / 7e-34 AT3G62930 140 / 6e-45 Thioredoxin superfamily protein (.1) Potri.002G209300 [exp] 112 / 1e-33 AT1G03020 143 / 7e-46 Thioredoxin superfamily protein (.1) Potri.010G021800 [exp] 105 / 6e-31 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.008G214600 [exp] 104 / 2e-30 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1) Potri.008G214800 [exp] 103 / 4e-30 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00462 [flax] [poplar] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Lus10005940 pacid=23146046 polypeptide=Lus10005940 locus=Lus10005940.g ID=Lus10005940.BGIv1.0 annot-version=v1.0 ATGGAAGCGATTACGAGGTTGGTGGGAGACAGGCCGGTGGTGATATTCAGCCGTAGCTCATGCGACATGTGCCACACGATCAAGGCTCTCATAAGCGGGT ACGGGGCCAACCCGACGGTGTACGAGCTGGACCAGATGGCTGAAGGTGCGGCCGTGGAGNNNNAAGGGGCGGCCGTGGAGATAGCCTTGGTTCAGCAGTT GGGTTGCCGCCCTAGTGTGCCGGCCGTGTTCATTGGCCAGCAGTTCGTTGGTGGGGACAAGCAAGTGATGAGCCTGCAGCTGAAGAACCGGCTGGCTCCA ATGCTCATGGGCGCCGGAGCCATCTGGGTTTGGAACGGCCACTAA
AA sequence Show only first row Show all	>Lus10005940 pacid=23146046 polypeptide=Lus10005940 locus=Lus10005940.g ID=Lus10005940.BGIv1.0 annot-version=v1.0 MEAITRLVGDRPVVIFSRSSCDMCHTIKALISGYGANPTVYELDQMAEGAAVEXXGAAVEIALVQQLGCRPSVPAVFIGQQFVGGDKQVMSLQLKNRLAP MLMGAGAIWVWNGH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62930			Thioredoxin superfamily protei...		Lus10005940 [exp]	0	1
AT4G32790			Exostosin family protein (.1)		Lus10014425 [exp]	2.4	0.8651
AT4G28570			Long-chain fatty alcohol dehyd...		Lus10021165 [exp]	3.3	0.8905
AT3G09590			CAP (Cysteine-rich secretory p...		Lus10009068 [exp]	3.5	0.8250
AT5G25820			Exostosin family protein (.1)		Lus10014424 [exp]	6.0	0.8433
AT3G62930			Thioredoxin superfamily protei...		Lus10029440 [exp]	6.9	0.8138
AT1G65390		ATPP2-A5	phloem protein 2 A5 (.1.2)		Lus10018301 [exp]	7.1	0.8527
AT2G26650		AKT1, ATAKT1	K+ transporter 1, K+ transport...		Lus10017765 [exp]	7.5	0.8579
AT2G26650		AKT1, ATAKT1	K+ transporter 1, K+ transport...		Lus10033052 [exp]	7.6	0.8673
AT5G04770		CAT6, ATCAT6	ARABIDOPSIS THALIANA CATIONIC ...		Lus10040142 [exp]	8.0	0.7960
AT1G50420	GRAS	SCL-3, SCL3	scarecrow-like 3 (.1)		Lus10016892 [exp]	8.4	0.8516

Compare expression of checked genes

Lus10005940 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.