Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62920 60 / 1e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029442 [exp] 83 / 2e-21 AT1G03010 155 / 1e-44 Phototropic-responsive NPH3 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G133600 [exp] 72 / 2e-18 AT3G62920 97 / 2e-28 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005942 pacid=23146053 polypeptide=Lus10005942 locus=Lus10005942.g ID=Lus10005942.BGIv1.0 annot-version=v1.0 ATGGCTCGATCTTTCTCCGGCTCCGGAAGCTTCTTTCACCTTCCAAGCTTTTTCAGGAAGCTGGAGCAAGAGGTGGAAACGGTGGTTAAGGTACTGCAGC CTGGACCGTTGGGGATAATAGAGCACAAATTCTCTAACGAGGAGATACGCGAGGCGAATGCTGCCGTCCGAAGGGCCGTGGAGAATTGGCGAAGGAATTC GCATCTGGAGCAGAGGAATGACTTTCTTAAGGATTTTCTTCAGAAATAA
AA sequence Show only first row Show all	>Lus10005942 pacid=23146053 polypeptide=Lus10005942 locus=Lus10005942.g ID=Lus10005942.BGIv1.0 annot-version=v1.0 MARSFSGSGSFFHLPSFFRKLEQEVETVVKVLQPGPLGIIEHKFSNEEIREANAAVRRAVENWRRNSHLEQRNDFLKDFLQK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62920			unknown protein		Lus10005942 [exp]	0	1
AT3G42150			unknown protein		Lus10011614 [exp]	1.0	0.8025
AT5G25760		PEX4, UBC21	ubiquitin-conjugating enzyme 2...		Lus10011695 [exp]	4.9	0.7622
AT2G39445			Phosphatidylinositol N-acetylg...		Lus10003796 [exp]	8.8	0.6816
AT1G79390			unknown protein		Lus10001838 [exp]	10.4	0.7710
AT4G38495			unknown protein		Lus10029400 [exp]	11.6	0.7714
AT4G35980			unknown protein		Lus10041889 [exp]	12.6	0.7981
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10030583 [exp]	23.6	0.7630
AT1G73177		APC13, BNS	anaphase-promoting complex 13,...		Lus10029234 [exp]	23.8	0.6955
AT1G11760		MED32	unknown protein		Lus10033295 [exp]	25.0	0.7265
AT3G18430			Calcium-binding EF-hand family...		Lus10022173 [exp]	26.2	0.7461

Compare expression of checked genes

Lus10005942 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.