Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05890 41 / 5e-06 RCI2B RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) AT2G38905 36 / 0.0003 Low temperature and salt responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029449 [exp] 109 / 8e-33 ND 89 / 1e-25 Lus10029450 [exp] 104 / 1e-30 ND 87 / 6e-25 Lus10014028 [exp] 69 / 9e-17 AT3G05880 84 / 5e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10019890 [exp] 66 / 2e-15 AT3G05880 85 / 3e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G002250 [exp] 61 / 1e-13 AT3G05890 66 / 2e-16 RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) Potri.013G001600 [exp] 57 / 3e-12 AT3G05880 70 / 3e-18 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.005G002100 [exp] 56 / 8e-12 AT3G05880 68 / 1e-17 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005948 pacid=23146036 polypeptide=Lus10005948 locus=Lus10005948.g ID=Lus10005948.BGIv1.0 annot-version=v1.0 ATGGGAGTCGTCGGCAATTACATGATGATGATGACGTCACTTGGTTATGGCGTAGATGGCGTAGATGATGCCAGGGATGTATCCAAGGATAGTGAGGAGC AAGCAGATCCAGAACTCAACCTGGCAGCCGAACTTGAGGAACACACCCAGAGGAGGCAACAGGATAGCCAGGATTATGTCTATGCAATTAGCGATGGCGT AGATGATGCCAGGGAGGTAGCCAAAGATAGTGAGGAGCAAACAGATCCAGAACTCTACATGACAACCGAACTTGAGGAACACACCCAGAGGCGGCAAAAG GATCGCCAGGATTATGTCTACGCAATTAGCTGTGCCTTCCTTCATGATGATTGA
AA sequence Show only first row Show all	>Lus10005948 pacid=23146036 polypeptide=Lus10005948 locus=Lus10005948.g ID=Lus10005948.BGIv1.0 annot-version=v1.0 MGVVGNYMMMMTSLGYGVDGVDDARDVSKDSEEQADPELNLAAELEEHTQRRQQDSQDYVYAISDGVDDAREVAKDSEEQTDPELYMTTELEEHTQRRQK DRQDYVYAISCAFLHDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10005948 [exp]	0	1
AT2G34930			disease resistance family prot...		Lus10039522 [exp]	2.0	0.7901
AT3G46510		ATPUB13	ARABIDOPSIS THALIANA PLANT U-B...		Lus10040834 [exp]	2.0	0.8094
AT2G34930			disease resistance family prot...		Lus10029483 [exp]	3.0	0.8144
AT1G19270		DA1	DA1 (.1)		Lus10032736 [exp]	5.9	0.7877
AT4G19380			Long-chain fatty alcohol dehyd...		Lus10037257 [exp]	6.9	0.8019
AT4G39260		ATGRP8, CCR1, G...	glycine-rich RNA-binding prote...		Lus10026343 [exp]	7.7	0.7331
AT2G37470			Histone superfamily protein (....		Lus10006484 [exp]	9.0	0.7234
					Lus10026392 [exp]	9.4	0.7648
AT3G63420		AGG1, ATAGG1	Ggamma-subunit 1 (.1.2)		Lus10029687 [exp]	10.5	0.7309
AT2G22560			Kinase interacting (KIP1-like)...		Lus10012730 [exp]	13.0	0.7795

Compare expression of checked genes

Lus10005948 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.