Lus10005948 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05890 41 / 5e-06 RCI2B RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1)
AT2G38905 36 / 0.0003 Low temperature and salt responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029449 109 / 8e-33 ND 89 / 1e-25
Lus10029450 104 / 1e-30 ND 87 / 6e-25
Lus10014028 69 / 9e-17 AT3G05880 84 / 5e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1)
Lus10019890 66 / 2e-15 AT3G05880 85 / 3e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G002250 61 / 1e-13 AT3G05890 66 / 2e-16 RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1)
Potri.013G001600 57 / 3e-12 AT3G05880 70 / 3e-18 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1)
Potri.005G002100 56 / 8e-12 AT3G05880 68 / 1e-17 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1)
PFAM info
Representative CDS sequence
>Lus10005948 pacid=23146036 polypeptide=Lus10005948 locus=Lus10005948.g ID=Lus10005948.BGIv1.0 annot-version=v1.0
ATGGGAGTCGTCGGCAATTACATGATGATGATGACGTCACTTGGTTATGGCGTAGATGGCGTAGATGATGCCAGGGATGTATCCAAGGATAGTGAGGAGC
AAGCAGATCCAGAACTCAACCTGGCAGCCGAACTTGAGGAACACACCCAGAGGAGGCAACAGGATAGCCAGGATTATGTCTATGCAATTAGCGATGGCGT
AGATGATGCCAGGGAGGTAGCCAAAGATAGTGAGGAGCAAACAGATCCAGAACTCTACATGACAACCGAACTTGAGGAACACACCCAGAGGCGGCAAAAG
GATCGCCAGGATTATGTCTACGCAATTAGCTGTGCCTTCCTTCATGATGATTGA
AA sequence
>Lus10005948 pacid=23146036 polypeptide=Lus10005948 locus=Lus10005948.g ID=Lus10005948.BGIv1.0 annot-version=v1.0
MGVVGNYMMMMTSLGYGVDGVDDARDVSKDSEEQADPELNLAAELEEHTQRRQQDSQDYVYAISDGVDDAREVAKDSEEQTDPELYMTTELEEHTQRRQK
DRQDYVYAISCAFLHDD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10005948 0 1
AT2G34930 disease resistance family prot... Lus10039522 2.0 0.7901
AT3G46510 ATPUB13 ARABIDOPSIS THALIANA PLANT U-B... Lus10040834 2.0 0.8094
AT2G34930 disease resistance family prot... Lus10029483 3.0 0.8144
AT1G19270 DA1 DA1 (.1) Lus10032736 5.9 0.7877
AT4G19380 Long-chain fatty alcohol dehyd... Lus10037257 6.9 0.8019
AT4G39260 ATGRP8, CCR1, G... glycine-rich RNA-binding prote... Lus10026343 7.7 0.7331
AT2G37470 Histone superfamily protein (.... Lus10006484 9.0 0.7234
Lus10026392 9.4 0.7648
AT3G63420 AGG1, ATAGG1 Ggamma-subunit 1 (.1.2) Lus10029687 10.5 0.7309
AT2G22560 Kinase interacting (KIP1-like)... Lus10012730 13.0 0.7795

Lus10005948 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.