Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042124 [exp] 43 / 2e-05 AT3G58310 46 / 1e-05 Domain of unknown function (DUF26) (.1) Lus10007507 [exp] 40 / 6e-05 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005955 pacid=23146067 polypeptide=Lus10005955 locus=Lus10005955.g ID=Lus10005955.BGIv1.0 annot-version=v1.0 ATGGGTCCAGACTTGAAGATTTTGGTGATCATCATCATCGCCAGCTCCCTACTACAATGGGGAGAGTCCAATGTGTTTGAAACTGTGTGCAATAAGGAAA CTTTCAACCCCAACACAGATCGAAAGTTCAACAGATGCGTCAATGAGATTAAGAACGTTCTTAAGGGTGATAATACACCGCCCACGTACGAGCCAGAGGT ATGTCTCGGCAAGGCTTTTTTTAGGTACTCTTGCCTTAATGAATGTAACGAAGCTTGTTGCACTAGATGCTGCAATGCGATCGGCATAGCCATGGACACA GATTGTGTGCACTCTGTTGGAGCACAATTCAACAATCTCGACTGTGAAGCCAGATACGAGACTTATCGCTTTTGA
AA sequence Show only first row Show all	>Lus10005955 pacid=23146067 polypeptide=Lus10005955 locus=Lus10005955.g ID=Lus10005955.BGIv1.0 annot-version=v1.0 MGPDLKILVIIIIASSLLQWGESNVFETVCNKETFNPNTDRKFNRCVNEIKNVLKGDNTPPTYEPEVCLGKAFFRYSCLNECNEACCTRCCNAIGIAMDT DCVHSVGAQFNNLDCEARYETYRF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10005955 [exp]	0	1
AT3G02125			unknown protein		Lus10013196 [exp]	1.0	0.9873
AT3G07610		IBM1	increase in bonsai methylation...		Lus10004549 [exp]	2.0	0.9338
AT3G24850	B3		Domain of unknown function (DU...		Lus10038802 [exp]	3.0	0.8616
AT3G02230		ATRGP1, RGP1	ARABIDOPSIS THALIANA REVERSIBL...		Lus10034376 [exp]	3.0	0.9304
AT3G05250			RING/U-box superfamily protein...		Lus10010911 [exp]	4.5	0.9129
					Lus10004431 [exp]	4.6	0.8747
AT1G77380		AAP3, ATAAP3	amino acid permease 3 (.1)		Lus10042741 [exp]	4.9	0.8767
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10018825 [exp]	6.7	0.8336
AT3G47440		TIP5;1	tonoplast intrinsic protein 5;...		Lus10031157 [exp]	8.5	0.8450
AT1G52560			HSP20-like chaperones superfam...		Lus10023653 [exp]	8.7	0.9078

Compare expression of checked genes

Lus10005955 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.