Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) AT1G07770 263 / 1e-92 RPS15A ribosomal protein S15A (.1.2) AT3G46040 262 / 3e-92 RPS15AD ribosomal protein S15A D (.1) AT2G39590 247 / 3e-86 Ribosomal protein S8 family protein (.1) AT4G29430 147 / 8e-47 RPS15AE ribosomal protein S15A E (.1) AT2G19720 142 / 8e-45 RPS15AB ribosomal protein S15A B (.1) ATCG00770 40 / 7e-05 ATCG00770.1, RPS8 ribosomal protein S8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023429 [exp] 267 / 7e-94 AT5G59850 264 / 9e-93 Ribosomal protein S8 family protein (.1) Lus10040309 [exp] 266 / 1e-93 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10043001 [exp] 266 / 1e-93 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2) Lus10029461 [exp] 266 / 1e-93 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10032503 [exp] 266 / 1e-93 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2) Lus10040543 [exp] 134 / 1e-41 AT4G29430 236 / 4e-82 ribosomal protein S15A E (.1) Lus10000975 [exp] 134 / 2e-41 AT4G29430 235 / 2e-81 ribosomal protein S15A E (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G208700 [exp] 259 / 5e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.001G118100 [exp] 259 / 5e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.003G114800 [exp] 259 / 5e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.008G051900 [exp] 257 / 4e-90 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.009G071250 [exp] 135 / 7e-42 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1) Potri.009G071400 [exp] 135 / 7e-42 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00410 [flax] [poplar] Ribosomal_S8 Ribosomal protein S8
Representative CDS sequence Show only first row Show all	>Lus10005960 pacid=23146041 polypeptide=Lus10005960 locus=Lus10005960.g ID=Lus10005960.BGIv1.0 annot-version=v1.0 ATGGTGAGGATTAGCGTTTTGAACGATGCTCTTAAGAGCATGTACAATGCAGAGAAGCGTGGTAAGCGCCAGGTCATGATCAGGCCTTCCTCGAAAGTGA TCATCAAGTTTCTTATTGTGATGCAGAAACATGGATACATCGGTGAGTTTGAATATGTTGATGACCACAGAGCTGGCAAAATTGTTGTGGAGTTGAATGG AAGGCTGAACAAGTGTGGTGTCATCAGCCCAAGATTTGACATTGGTGTCAAGGAGATCGAAGGCTGGACTGCTCGCTTGCTTCCATCTAGACAGTTTGGA TTCATTGTGTTGACAACTTCTGCTGGCATTATGGACCACGAGGAAGCAAGAAGGAAGAATGTTGGAGGAAAAGTGCTTGGCTTCTTCTACTAA
AA sequence Show only first row Show all	>Lus10005960 pacid=23146041 polypeptide=Lus10005960 locus=Lus10005960.g ID=Lus10005960.BGIv1.0 annot-version=v1.0 MVRISVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFG FIVLTTSAGIMDHEEARRKNVGGKVLGFFY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59850			Ribosomal protein S8 family pr...		Lus10005960 [exp]	0	1
AT5G59850			Ribosomal protein S8 family pr...		Lus10029461 [exp]	1.0	0.9897
AT4G29410			Ribosomal L28e protein family ...		Lus10032699 [exp]	4.2	0.9537
AT5G12110			Glutathione S-transferase, C-t...		Lus10026784 [exp]	7.7	0.9176
AT1G26880			Ribosomal protein L34e superfa...		Lus10037177 [exp]	7.7	0.9366
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10011773 [exp]	7.9	0.9203
AT1G16470		PAB1	proteasome subunit PAB1 (.1.2)		Lus10036210 [exp]	8.5	0.8995
AT2G41950			unknown protein		Lus10016243 [exp]	9.6	0.8816
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10031979 [exp]	9.6	0.9271
AT5G47320		RPS19	ribosomal protein S19 (.1)		Lus10027711 [exp]	11.0	0.8961
AT1G29990		PFD6, PDF6	prefoldin 6 (.1)		Lus10038496 [exp]	12.7	0.8629

Compare expression of checked genes

Lus10005960 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.