Lus10005969 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G46520 197 / 2e-58 cellular apoptosis susceptibility protein, putative / importin-alpha re-exporter, putative (.1)
AT3G59020 47 / 6e-06 ARM repeat superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030241 293 / 1e-93 AT2G46520 1438 / 0.0 cellular apoptosis susceptibility protein, putative / importin-alpha re-exporter, putative (.1)
Lus10030434 174 / 3e-52 AT2G46520 449 / 6e-149 cellular apoptosis susceptibility protein, putative / importin-alpha re-exporter, putative (.1)
Lus10026726 47 / 7e-06 AT2G31660 1084 / 0.0 UNARMED 9, SUPER SENSITIVE TO ABA AND DROUGHT2, enhanced miRNA activity 1, ARM repeat superfamily protein (.1)
Lus10025509 46 / 1e-05 AT2G31660 1591 / 0.0 UNARMED 9, SUPER SENSITIVE TO ABA AND DROUGHT2, enhanced miRNA activity 1, ARM repeat superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G100000 223 / 2e-67 AT2G46520 1464 / 0.0 cellular apoptosis susceptibility protein, putative / importin-alpha re-exporter, putative (.1)
Potri.002G172700 218 / 8e-66 AT2G46520 1421 / 0.0 cellular apoptosis susceptibility protein, putative / importin-alpha re-exporter, putative (.1)
Potri.014G149600 45 / 1e-05 AT2G31660 1543 / 0.0 UNARMED 9, SUPER SENSITIVE TO ABA AND DROUGHT2, enhanced miRNA activity 1, ARM repeat superfamily protein (.1)
Potri.002G232600 44 / 7e-05 AT2G31660 1499 / 0.0 UNARMED 9, SUPER SENSITIVE TO ABA AND DROUGHT2, enhanced miRNA activity 1, ARM repeat superfamily protein (.1)
Potri.008G109300 41 / 0.0005 AT1G26170 1339 / 0.0 ARM repeat superfamily protein (.1)
Potri.T108626 40 / 0.0007 AT1G26170 1345 / 0.0 ARM repeat superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF08506 Cse1 Cse1
CL0020 TPR PF08389 Xpo1 Exportin 1-like protein
CL0020 TPR PF03810 IBN_N Importin-beta N-terminal domain
Representative CDS sequence
>Lus10005969 pacid=23175070 polypeptide=Lus10005969 locus=Lus10005969.g ID=Lus10005969.BGIv1.0 annot-version=v1.0
ATGGATTTGAGCCCCAATTTCCTCGCCCAGTGCTTCGTTGACACACTCTCCCTAGCTCGGGAGACCCGCAGGGCCGGCGAGGACCGCCTCCAAGCAGCCG
CGAACGCTCCAAACTACGCGCTCGCCGTTCTTAACTTGGTCGGTACGCCGTCCGTCGACGACCAGATCCGTCGCGCGGCGGCTGTCAACTTCAAGAACCA
CCTCCGCCAGCGATGGGTGCCGGGACAGGATTCCGACTTCAATCCGATCTCCGATGACGAGAAGAACCAAATCAAAAACCTAATCGTCTCTCTCATGCTA
TCGTCGTCTCCTCAGATCCAGTCGCAGCTCAGTGAAGCCCTTTCTCTAATCGGTAAACACGATTTCCCTAAACTGTGGGCATCTTTGCTCCCTGAGCTCG
TCGCCAATCTCCAGGCTGCATCGCAGGCCAACAATTACGCTACTGTCAATGGTATTCTCGAGACGGCTAACTCGATCTTTAAGAAGTTCCGGTATCAGTA
TAAGAGTAACGAGCTTTTCCTTGAATTGAAGTATTGTCTTGATAACTTTGCTGCTCCGTTTTATTATTTTTGCCCACCTGTCGTTGAAATGGTCCCGAAA
CCCTGCCGCACTTATAGACTCTGCAGTTAG
AA sequence
>Lus10005969 pacid=23175070 polypeptide=Lus10005969 locus=Lus10005969.g ID=Lus10005969.BGIv1.0 annot-version=v1.0
MDLSPNFLAQCFVDTLSLARETRRAGEDRLQAAANAPNYALAVLNLVGTPSVDDQIRRAAAVNFKNHLRQRWVPGQDSDFNPISDDEKNQIKNLIVSLML
SSSPQIQSQLSEALSLIGKHDFPKLWASLLPELVANLQAASQANNYATVNGILETANSIFKKFRYQYKSNELFLELKYCLDNFAAPFYYFCPPVVEMVPK
PCRTYRLCS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G46520 cellular apoptosis susceptibil... Lus10005969 0 1
AT2G07820 unknown protein Lus10015035 2.2 0.9674
AT3G08960 ARM repeat superfamily protein... Lus10004753 4.1 0.9495
AT5G23430 Transducin/WD40 repeat-like su... Lus10041007 7.2 0.9404
AT3G02260 CRM1, TIR3, LPR... UMBRELLA 1, TRANSPORT INHIBITO... Lus10000087 7.3 0.9610
AT3G12440 Polynucleotidyl transferase, r... Lus10000103 7.5 0.9604
AT4G16340 SPK1 SPIKE1, guanyl-nucleotide exch... Lus10013253 8.4 0.9371
AT1G64790 ILA ILITYHIA (.1.2) Lus10003102 8.9 0.9588
AT1G20960 EMB1507 embryo defective 1507, U5 smal... Lus10025169 9.0 0.9606
AT3G07100 AtSEC24A, SEC24... ENDOPLASMIC RETICULUM MORPHOLO... Lus10013101 9.2 0.9506
AT3G63460 EMB2221 transducin family protein / WD... Lus10016374 9.8 0.9544

Lus10005969 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.