Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G59750 75 / 4e-17 ARF ARF1 auxin response factor 1 (.1.2.3.4) AT3G61830 72 / 5e-16 ARF ARF18 auxin response factor 18 (.1) AT5G62000 69 / 4e-15 ARF ORE14, HSS, ARF1-BP, ARF2 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4) AT2G46530 64 / 5e-13 ARF ARF11 auxin response factor 11 (.1.2.3) AT1G34170 62 / 2e-12 ARF ARF13 AUXIN RESPONSE FACTOR 13 (.1.2.3) AT4G23980 59 / 1e-11 ARF ARF9 auxin response factor 9 (.1.2) AT1G35540 55 / 5e-10 ARF ARF14 auxin response factor 14 (.1) AT1G34410 53 / 2e-09 ARF ARF21 auxin response factor 21 (.1) AT1G34310 53 / 2e-09 ARF ARF12 auxin response factor 12 (.1) AT1G43950 52 / 3e-09 ARF ARF23 auxin response factor 23 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030240 [exp] 130 / 3e-37 AT2G46530 381 / 1e-126 auxin response factor 11 (.1.2.3) Lus10041340 [exp] 111 / 4e-30 AT3G61830 370 / 2e-122 auxin response factor 18 (.1) Lus10024455 [exp] 82 / 1e-19 AT1G59750 905 / 0.0 auxin response factor 1 (.1.2.3.4) Lus10007440 [exp] 80 / 9e-19 AT1G59750 917 / 0.0 auxin response factor 1 (.1.2.3.4) Lus10032541 [exp] 74 / 9e-17 AT5G62000 1095 / 0.0 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4) Lus10043200 [exp] 73 / 3e-16 AT5G62000 1091 / 0.0 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4) Lus10023058 [exp] 69 / 4e-15 AT4G23980 743 / 0.0 auxin response factor 9 (.1.2) Lus10005930 [exp] 62 / 2e-12 AT5G62000 361 / 2e-112 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4) Lus10040906 [exp] 61 / 3e-12 AT5G62000 367 / 2e-114 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G228800 [exp] 80 / 9e-19 AT1G59750 906 / 0.0 auxin response factor 1 (.1.2.3.4) Potri.003G001000 [exp] 76 / 3e-17 AT1G59750 898 / 0.0 auxin response factor 1 (.1.2.3.4) Potri.001G066200 [exp] 73 / 2e-16 AT5G62000 765 / 0.0 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4) Potri.012G106100 [exp] 72 / 4e-16 AT5G62000 1035 / 0.0 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4) Potri.003G142100 [exp] 69 / 4e-15 AT4G23980 706 / 0.0 auxin response factor 9 (.1.2) Potri.014G100100 [exp] 68 / 1e-14 AT4G23980 694 / 0.0 auxin response factor 9 (.1.2) Potri.002G172800 [exp] 68 / 1e-14 AT4G23980 662 / 0.0 auxin response factor 9 (.1.2) Potri.015G105300 [exp] 68 / 1e-14 AT5G62000 1065 / 0.0 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4) Potri.003G163600 [exp] 68 / 2e-14 AT5G62000 691 / 0.0 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4) Potri.001G088600 [exp] 66 / 4e-14 AT4G23980 710 / 0.0 auxin response factor 9 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005970 pacid=23175076 polypeptide=Lus10005970 locus=Lus10005970.g ID=Lus10005970.BGIv1.0 annot-version=v1.0 ATGGCTTCTGCTAATGTTCCAACTGGTTCATCTTCCTCAAGGGTCAATAAGAATGATGCTCTGCTTGATCAGCTCTGGAACGTATGTGCAAGAACAACAT ATGGTATCCCGAAAGAAGAAGAAATGGTTTACTATTTCCTCCAGGGACACATGGAACAACTGCAAGGGACGATGAACGTGCAACATGACCACCAAATCAC TGTCTACGACTTCCCTTGCAAAATCTTTTGCCAAATTATCAACGTCACGAGAATGGTCGGGATTTACCTAACTGTTGTGTCACAAAGCGACAATCTATGG TAG
AA sequence Show only first row Show all	>Lus10005970 pacid=23175076 polypeptide=Lus10005970 locus=Lus10005970.g ID=Lus10005970.BGIv1.0 annot-version=v1.0 MASANVPTGSSSSRVNKNDALLDQLWNVCARTTYGIPKEEEMVYYFLQGHMEQLQGTMNVQHDHQITVYDFPCKIFCQIINVTRMVGIYLTVVSQSDNLW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G59750	ARF	ARF1	auxin response factor 1 (.1.2....		Lus10005970 [exp]	0	1

Compare expression of checked genes

Lus10005970 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.