Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G07950 102 / 2e-29 DNA-directed RNA polymerase, subunit M, archaeal (.1) AT1G01210 101 / 4e-29 DNA-directed RNA polymerase, subunit M, archaeal (.1) AT2G38560 39 / 0.0002 RDO2, TFIIS REDUCED DORMANCY 2, transcript elongation factor IIS (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030228 [exp] 199 / 3e-67 AT4G07950 120 / 6e-36 DNA-directed RNA polymerase, subunit M, archaeal (.1) Lus10025131 [exp] 40 / 0.0001 AT2G38560 387 / 6e-134 REDUCED DORMANCY 2, transcript elongation factor IIS (.1) Lus10025215 [exp] 40 / 0.0001 AT2G38560 384 / 8e-133 REDUCED DORMANCY 2, transcript elongation factor IIS (.1) Lus10034247 [exp] 40 / 0.0001 AT2G38560 295 / 1e-98 REDUCED DORMANCY 2, transcript elongation factor IIS (.1) Lus10022735 [exp] 39 / 0.0003 AT2G38560 375 / 2e-129 REDUCED DORMANCY 2, transcript elongation factor IIS (.1) Lus10014178 [exp] 39 / 0.0003 AT2G38560 384 / 1e-132 REDUCED DORMANCY 2, transcript elongation factor IIS (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G015900 [exp] 166 / 1e-54 AT4G07950 124 / 5e-38 DNA-directed RNA polymerase, subunit M, archaeal (.1) Potri.016G138100 [exp] 41 / 6e-05 AT2G38560 402 / 3e-140 REDUCED DORMANCY 2, transcript elongation factor IIS (.1) Potri.006G109300 [exp] 39 / 0.0002 AT2G38560 393 / 2e-136 REDUCED DORMANCY 2, transcript elongation factor IIS (.1) Potri.010G142500 [exp] 38 / 0.0002 AT4G16265 146 / 3e-47 RNA polymerases M/15 Kd subunit (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF01096 [flax] [poplar] TFIIS_C Transcription factor S-II (TFIIS)
Representative CDS sequence Show only first row Show all	>Lus10005984 pacid=23175057 polypeptide=Lus10005984 locus=Lus10005984.g ID=Lus10005984.BGIv1.0 annot-version=v1.0 ATGGAGTTCTGCCCAACCTGCGGAACTTTGTTGAAGTATGAGTTGCCAAGTATGGGCGATCCGGCCAGGTTCTTCTGCCGGACTTGTCCTTATATCTGTT CACTTCAGGGCAGGAATAAGATCAAGAGGAAGCTACAGCTTCAGAAGAAGGAACTCGAATCGGTTTTCACCCTCGACGATATGATGAAGGGCGGCTCTGA AACTGAAGCAACATGTCCTCATTGTAACTTCGGGAAGGCGCGTTTTCAGCAGCTGCAAACTCGATCAGCTGACGAGCCAGCCACCACTTTTTACTTCTGC CTCAATGAGAAGTGTTCGAGAATGTGGCGCGAGGACTGA
AA sequence Show only first row Show all	>Lus10005984 pacid=23175057 polypeptide=Lus10005984 locus=Lus10005984.g ID=Lus10005984.BGIv1.0 annot-version=v1.0 MEFCPTCGTLLKYELPSMGDPARFFCRTCPYICSLQGRNKIKRKLQLQKKELESVFTLDDMMKGGSETEATCPHCNFGKARFQQLQTRSADEPATTFYFC LNEKCSRMWRED

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01210			DNA-directed RNA polymerase, s...		Lus10005984 [exp]	0	1
AT5G05670			signal recognition particle bi...		Lus10030896 [exp]	3.9	0.8710
AT2G28430			unknown protein		Lus10021477 [exp]	13.8	0.8726
AT1G35620		ATPDI8, ATPDIL5...	ARABIDOPSIS THALIANA PROTEIN D...		Lus10022494 [exp]	14.5	0.8563
AT1G52740		HTA9	histone H2A protein 9 (.1)		Lus10043301 [exp]	15.2	0.8510
AT3G60540			Preprotein translocase Sec, Se...		Lus10010009 [exp]	17.0	0.8665
AT3G15352		ATCOX17	ARABIDOPSIS THALIANA CYTOCHROM...		Lus10035780 [exp]	22.0	0.8417
AT2G02760		ATUBC2	ubiquitin-conjugating enzyme 2...		Lus10037203 [exp]	32.9	0.8642
AT3G50520			Phosphoglycerate mutase family...		Lus10014360 [exp]	34.9	0.8372
AT5G14290			Mitochondrial ribosomal protei...		Lus10022331 [exp]	36.1	0.7967
AT2G40110			Yippee family putative zinc-bi...		Lus10040190 [exp]	38.6	0.8567

Compare expression of checked genes

Lus10005984 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.