Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006006 pacid=23140005 polypeptide=Lus10006006 locus=Lus10006006.g ID=Lus10006006.BGIv1.0 annot-version=v1.0 ATGCCTCATGCTGATTCGAAGCCGGTGATTGACGAAGAGGACTTGGAAGAGCAAATAGAGTTTGAGAATGGTGAAGGTGAAGGTGCAACCTCAGCGAGTG CTAGTGTGATTGGGGGATCTTTTGATGAAGATGAAAACGATGAAGATGAAAATGATGAAGACGAAGAGGGTAAAAACGAATGTGTTGATCCTGTAAATAT TCTTAAATTTATTTCCAGTTACTGA
AA sequence Show only first row Show all	>Lus10006006 pacid=23140005 polypeptide=Lus10006006 locus=Lus10006006.g ID=Lus10006006.BGIv1.0 annot-version=v1.0 MPHADSKPVIDEEDLEEQIEFENGEGEGATSASASVIGGSFDEDENDEDENDEDEEGKNECVDPVNILKFISSY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006006 [exp]	0	1
AT3G07310			Protein of unknown function (D...		Lus10025896 [exp]	1.0	0.9678
AT1G67580		CDKG;2	Protein kinase superfamily pro...		Lus10015816 [exp]	1.7	0.9387
AT5G66930			unknown protein		Lus10019643 [exp]	2.4	0.9544
AT1G28560		SRD2	SHOOT REDIFFERENTIATION DEFECT...		Lus10017968 [exp]	2.8	0.9372
AT3G47160			RING/U-box superfamily protein...		Lus10005859 [exp]	3.6	0.9247
AT2G30070		ATKUP1, ATKT1P,...	POTASSIUM UPTAKE TRANSPORTER 1...		Lus10032154 [exp]	8.4	0.9257
AT3G52905			Polynucleotidyl transferase, r...		Lus10008532 [exp]	11.5	0.8857
AT2G17020			F-box/RNI-like superfamily pro...		Lus10025093 [exp]	11.6	0.9289
AT4G33580		ATBCA5	A. THALIANA BETA CARBONIC ANHY...		Lus10015892 [exp]	12.0	0.9334
AT3G56680			Single-stranded nucleic acid b...		Lus10038997 [exp]	13.0	0.9241

Compare expression of checked genes

Lus10006006 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.