Lus10006007 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G08315 110 / 2e-29 ARM repeat superfamily protein (.1)
AT4G38650 51 / 1e-07 Glycosyl hydrolase family 10 protein (.1)
AT4G38300 50 / 1e-07 glycosyl hydrolase family 10 protein (.1)
AT4G33860 42 / 0.0001 Glycosyl hydrolase family 10 protein (.1)
AT4G33840 42 / 0.0001 Glycosyl hydrolase family 10 protein (.1)
AT5G67340 40 / 0.0004 ARM repeat superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024145 150 / 7e-45 AT1G08315 390 / 2e-136 ARM repeat superfamily protein (.1)
Lus10008655 149 / 2e-44 AT1G08315 393 / 5e-138 ARM repeat superfamily protein (.1)
Lus10039500 148 / 7e-42 AT1G08315 383 / 2e-129 ARM repeat superfamily protein (.1)
Lus10026170 96 / 7e-26 AT1G08315 106 / 6e-29 ARM repeat superfamily protein (.1)
Lus10034490 75 / 5e-16 AT4G38650 566 / 0.0 Glycosyl hydrolase family 10 protein (.1)
Lus10025054 75 / 7e-16 AT4G38650 677 / 0.0 Glycosyl hydrolase family 10 protein (.1)
Lus10033784 42 / 0.0001 AT4G33820 480 / 2e-160 Glycosyl hydrolase superfamily protein (.1)
Lus10014646 42 / 0.0001 AT4G33820 336 / 6e-110 Glycosyl hydrolase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G195400 124 / 7e-35 AT1G08315 364 / 1e-126 ARM repeat superfamily protein (.1)
Potri.001G028300 120 / 2e-33 AT1G08315 343 / 3e-118 ARM repeat superfamily protein (.1)
Potri.004G173300 49 / 5e-07 AT4G38650 753 / 0.0 Glycosyl hydrolase family 10 protein (.1)
Potri.009G087700 44 / 3e-05 AT4G33860 529 / 0.0 Glycosyl hydrolase family 10 protein (.1)
Potri.009G087800 42 / 0.0002 AT4G33840 573 / 0.0 Glycosyl hydrolase family 10 protein (.1)
Potri.009G087900 39 / 0.001 AT4G33840 695 / 0.0 Glycosyl hydrolase family 10 protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF00514 Arm Armadillo/beta-catenin-like repeat
Representative CDS sequence
>Lus10006007 pacid=23139993 polypeptide=Lus10006007 locus=Lus10006007.g ID=Lus10006007.BGIv1.0 annot-version=v1.0
ATGGGTAACAGAGGAAGCAAAACTGATCTATGGAGCAGCCGCCGCCTCAACATCTTCTGGGAAGATCCAAAATACACACCCGAATGGGTCAAACAACTCG
CCGACAACCAACTCCACGCCGTCGTCGAATCAAGAATCCGGAGCCTGATGAATCTGCCCATTTGGGTCAACGAAGTCGACATCAAGAAGAAGTTCGACTC
CCAAACCCATCTGAATCGGTCCATGATGATTGATCTGGGAGTGGCTCTACCGCTGTTCTTGCTGGTGGTCAAGGACGGGAGGGTGGGGATCGTGGAGGAT
GCGACGACTGTGATCGCTCAGACCGTCGGATGCGAGAAGAGCGAGGCAGAATTCAGGAGGGTGTCTGGAATTAGGGTACTAGTGGATCTATTAGATGTGG
GGACTGGATCGAGCGATAGGGTAAAGGAGAACGCGGTGGGGGCGTTGTTGAATCTGATGAGGAGTGGAAGGAACGCTAGCGGCGAGAGAGGTAGTTACGA
TTTAAAGAGGAGATGTTGA
AA sequence
>Lus10006007 pacid=23139993 polypeptide=Lus10006007 locus=Lus10006007.g ID=Lus10006007.BGIv1.0 annot-version=v1.0
MGNRGSKTDLWSSRRLNIFWEDPKYTPEWVKQLADNQLHAVVESRIRSLMNLPIWVNEVDIKKKFDSQTHLNRSMMIDLGVALPLFLLVVKDGRVGIVED
ATTVIAQTVGCEKSEAEFRRVSGIRVLVDLLDVGTGSSDRVKENAVGALLNLMRSGRNASGERGSYDLKRRC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G08315 ARM repeat superfamily protein... Lus10006007 0 1
AT1G10385 Vps51/Vps67 family (components... Lus10033648 1.0 0.9566
AT5G14870 ATCNGC18 cyclic nucleotide-gated channe... Lus10039415 2.0 0.9311
AT5G01300 PEBP (phosphatidylethanolamine... Lus10003388 2.2 0.8636
Lus10019456 2.4 0.9021
AT5G01750 Protein of unknown function (D... Lus10007360 2.6 0.8291
AT1G28270 RALFL4 ralf-like 4 (.1) Lus10015431 2.8 0.8231
AT3G16650 Transducin/WD40 repeat-like su... Lus10001473 3.0 0.8170
AT1G51990 O-methyltransferase family pro... Lus10033647 4.0 0.8976
AT1G12920 ERF1-2 eukaryotic release factor 1-2 ... Lus10041760 6.3 0.7332
AT4G23160 CRK8 cysteine-rich RLK (RECEPTOR-li... Lus10024900 6.5 0.8321

Lus10006007 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.