Lus10006020 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G72750 207 / 2e-68 ATTIM23-2 translocase inner membrane subunit 23-2 (.1)
AT1G17530 205 / 1e-67 ATTIM23-1 translocase of inner mitochondrial membrane 23 (.1)
AT3G04800 129 / 1e-37 ATTIM23-3 translocase inner membrane subunit 23-3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008470 292 / 6e-102 AT1G17530 244 / 3e-83 translocase of inner mitochondrial membrane 23 (.1)
Lus10009183 153 / 2e-47 AT1G17530 198 / 4e-65 translocase of inner mitochondrial membrane 23 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G044100 229 / 3e-77 AT1G17530 179 / 9e-58 translocase of inner mitochondrial membrane 23 (.1)
Potri.001G198100 229 / 3e-77 AT1G17530 154 / 6e-48 translocase of inner mitochondrial membrane 23 (.1)
Potri.013G039200 151 / 9e-47 AT3G04800 190 / 5e-62 translocase inner membrane subunit 23-3 (.1)
Potri.005G051800 147 / 3e-45 AT3G04800 187 / 4e-61 translocase inner membrane subunit 23-3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02466 Tim17 Tim17/Tim22/Tim23/Pmp24 family
Representative CDS sequence
>Lus10006020 pacid=23174238 polypeptide=Lus10006020 locus=Lus10006020.g ID=Lus10006020.BGIv1.0 annot-version=v1.0
ATGGCTTTCTCCCACTCCGATCACAATCGCGATCCCGATTCTTCTCGCCACCAATCTGAACACACCAGGCTATACAACCCTTACCAGGACCTCAACACCC
CAATCAAAACCCTATACAATCTCCCAACCTCGCCAGAGTACCTCTTCTCCGAGGAATCCGTGAAGCAGCGCCGTTCCTGGGGTGAGAATCTCACCTTCTA
CACCGGAACCGCCTACCTGGGCGCATCTGTCGGCGGAGGCGGCGTTGGGCTTTTCTCCGCTGTGAAGTCGTTCGAGGCTAACGACACGTTGAAGCTAAAG
GTGAATAGGGTTCTGAACAGTTCGGGTCACTCAGGTCGGGTTTGGGGGAACCGGATCGGGATCGTTGGGTTGATCTATGCGATGACGGAGAGTGGGATTG
TGGCGGCTACTGATAAGGATGATGTTTGGACAAGTGTGGCGGCTGGGCTTGGGACAGGCGCTGTTTGCAGAGCGGCTAGAGGGTTGAGGTCTGCTGCGGT
GGCCGGTGCTTTGGGAGGTCTTGCTGCGGGAGCTGTGGTGGCCGGGAAGCAGGCGATGAAGAGGTATGCTATGATTTGA
AA sequence
>Lus10006020 pacid=23174238 polypeptide=Lus10006020 locus=Lus10006020.g ID=Lus10006020.BGIv1.0 annot-version=v1.0
MAFSHSDHNRDPDSSRHQSEHTRLYNPYQDLNTPIKTLYNLPTSPEYLFSEESVKQRRSWGENLTFYTGTAYLGASVGGGGVGLFSAVKSFEANDTLKLK
VNRVLNSSGHSGRVWGNRIGIVGLIYAMTESGIVAATDKDDVWTSVAAGLGTGAVCRAARGLRSAAVAGALGGLAAGAVVAGKQAMKRYAMI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17530 ATTIM23-1 translocase of inner mitochond... Lus10006020 0 1
AT2G15320 Leucine-rich repeat (LRR) fami... Lus10002822 3.5 0.9346
AT3G16050 A37, ATPDX1.2 ARABIDOPSIS THALIANA PYRIDOXIN... Lus10037545 3.9 0.9381
AT1G67330 Protein of unknown function (D... Lus10037026 5.5 0.9165
AT3G48700 ATCXE13 carboxyesterase 13 (.1) Lus10012073 7.1 0.9210
AT3G06200 P-loop containing nucleoside t... Lus10041236 7.5 0.8380
AT2G47840 AtTic20-II translocon at the inner envelo... Lus10026842 9.0 0.8745
AT5G12020 HSP17.6II 17.6 kDa class II heat shock p... Lus10025005 10.8 0.9188
AT3G12050 Aha1 domain-containing protein... Lus10017240 11.5 0.9077
AT5G52640 AtHsp90-1, ATHS... HEAT SHOCK PROTEIN 83, HEAT SH... Lus10027518 14.3 0.9159
AT5G13890 Family of unknown function (DU... Lus10041505 15.7 0.8617

Lus10006020 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.