Lus10006042 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32870 145 / 3e-45 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT2G25770 112 / 5e-32 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
AT1G70850 41 / 0.0002 MLP34 MLP-like protein 34 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000573 270 / 4e-94 AT4G32870 144 / 1e-44 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10005477 121 / 1e-35 AT2G25770 172 / 2e-55 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10026898 76 / 4e-18 AT2G25770 128 / 2e-38 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10028262 63 / 9e-13 AT2G25770 75 / 2e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10040227 62 / 2e-12 AT2G25770 75 / 6e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G236800 170 / 4e-54 AT4G32870 179 / 1e-57 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G237000 162 / 7e-52 AT4G32870 180 / 9e-59 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G237100 150 / 4e-47 AT4G32870 178 / 8e-58 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.018G046100 119 / 6e-35 AT2G25770 188 / 1e-61 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.008G063900 63 / 5e-13 AT4G32870 80 / 2e-19 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.010G193200 50 / 9e-09 AT2G25770 59 / 4e-12 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.006G237050 0 / 1 AT4G32870 0 / 1 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence
>Lus10006042 pacid=23146582 polypeptide=Lus10006042 locus=Lus10006042.g ID=Lus10006042.BGIv1.0 annot-version=v1.0
ATGCAGCAGCCAAAGCGATGGGAAGGCAAGGCGACGGCGGAACTCAAATTACCCGCAGAGCAAGTGTGGCCGGGTTTCGACCGCGACTTCTGCAGTCTCC
ACAAGTGGTCCCCCAATCTGGACACGTGTCACCAGCTGGAAGGTGTGGTCGGGCAGCCTGGATTGGTCCGTTACTGCACTTTCAAGTCCAGTTGGTGCAA
GGAACGACTGCTCGCCATCGATCCATCCGACCGATGCTTGAGCTACGAGATTCTGGACAACAACATCGGCTTCGGATCCTACGTTGCCACTGTCAGGGTT
GTTGATCAGCCGCCCGGAGATTGCTGCAGGATTGAATGGTCGTTCGTTGCTGAGCCAGTCACCGGTTGGACCTTAGAGGGTTTGAATTCGTACCTCAGTT
CCAGCTTGGATTACATGGCTTCCAAAATCCAGGCGGAAATTAATAATGGAGAGCTTACTGTGTAA
AA sequence
>Lus10006042 pacid=23146582 polypeptide=Lus10006042 locus=Lus10006042.g ID=Lus10006042.BGIv1.0 annot-version=v1.0
MQQPKRWEGKATAELKLPAEQVWPGFDRDFCSLHKWSPNLDTCHQLEGVVGQPGLVRYCTFKSSWCKERLLAIDPSDRCLSYEILDNNIGFGSYVATVRV
VDQPPGDCCRIEWSFVAEPVTGWTLEGLNSYLSSSLDYMASKIQAEINNGELTV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G32870 Polyketide cyclase/dehydrase a... Lus10006042 0 1
AT3G45070 P-loop containing nucleoside t... Lus10003070 1.7 0.9638
AT2G22475 GEM GL2-EXPRESSION MODULATOR, GRAM... Lus10010279 2.4 0.9542
Lus10032860 4.0 0.9587
AT5G63710 Leucine-rich repeat protein ki... Lus10035959 4.9 0.9509
Lus10010378 6.3 0.9495
AT5G24860 ATFPF1, FPF1 ARABIDOPSIS FLOWERING PROMOTIN... Lus10000506 7.5 0.8831
AT4G17720 RNA-binding (RRM/RBD/RNP motif... Lus10011063 7.5 0.9417
Lus10003556 8.0 0.9397
Lus10038232 8.1 0.9488
AT4G32870 Polyketide cyclase/dehydrase a... Lus10000573 8.4 0.9324

Lus10006042 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.