Lus10006050 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G44960 250 / 3e-84 SNARE associated Golgi protein family (.1)
AT1G12450 47 / 2e-06 SNARE associated Golgi protein family (.1)
AT4G12000 42 / 0.0001 SNARE associated Golgi protein family (.1)
AT1G03260 41 / 0.0002 SNARE associated Golgi protein family (.1)
AT4G22850 40 / 0.0008 SNARE associated Golgi protein family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028709 328 / 4e-115 AT1G44960 305 / 5e-105 SNARE associated Golgi protein family (.1)
Lus10006674 40 / 0.0007 AT1G12450 365 / 4e-127 SNARE associated Golgi protein family (.1)
Lus10007018 40 / 0.0007 AT1G12450 364 / 6e-127 SNARE associated Golgi protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G070800 274 / 8e-94 AT1G44960 278 / 2e-94 SNARE associated Golgi protein family (.1)
Potri.003G159901 159 / 1e-50 AT1G44960 152 / 2e-47 SNARE associated Golgi protein family (.1)
Potri.003G117400 45 / 2e-05 AT1G12450 343 / 1e-118 SNARE associated Golgi protein family (.1)
Potri.001G114600 40 / 0.0006 AT1G12450 317 / 3e-108 SNARE associated Golgi protein family (.1)
Potri.001G078700 40 / 0.0006 AT2G02370 390 / 2e-136 SNARE associated Golgi protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09335 SNARE_assoc SNARE associated Golgi protein
Representative CDS sequence
>Lus10006050 pacid=23147750 polypeptide=Lus10006050 locus=Lus10006050.g ID=Lus10006050.BGIv1.0 annot-version=v1.0
ATGCCTCTTTACGTTGGTGTTCACTCTCTAACATTGGCTCTCTGTTTGCCATTTGCCGTGTTCTTCGAAGCCGCTGCTTCTCTCCTCTTCGGCTTCTTCC
CTGCCCTTCTCTGCGTCTTCTCTGCCAAGGTCCTTGGCGCTTCCCTCTCCTTCTGGATCGGCAGGCTAGTGTTCAGGAGATCAAAGGCAGCAGCGGAGTG
GGTGCAAAGGAACAAATACTTCAACATCCTGTCGAAAGGGGTCGAGAGAGACGGATGGAGATTCGTCCTTCTGGCCCGATTCTCTCCTGTGCCGTCGTAC
ATGATAAACTACGCACTAGCTGCCACAGGAGTTGGGTTCTTAAAGGACTTTCTGCTGCCTACTGTAGTAGGATGCCTGCCGATGATTCTACAGAACACAT
CCATAGGCAGCCTTGCTGGTGCAGCCGTCTCTGGGGGAGGTGAGAAGTCCAAGGTTTGGTCGTACTTGTTTCCGTTGCTCGGGATTTCGTCGAGCGTCGT
TATTACCTTGAGGATTAGGAAGTACACAACTGACTTCACACTTGTTCAGACTGATGATGACAGTGCCGATTCTTCTCAAGCTGAGAAGAAGAACCAGAAG
AAAGTATCATGA
AA sequence
>Lus10006050 pacid=23147750 polypeptide=Lus10006050 locus=Lus10006050.g ID=Lus10006050.BGIv1.0 annot-version=v1.0
MPLYVGVHSLTLALCLPFAVFFEAAASLLFGFFPALLCVFSAKVLGASLSFWIGRLVFRRSKAAAEWVQRNKYFNILSKGVERDGWRFVLLARFSPVPSY
MINYALAATGVGFLKDFLLPTVVGCLPMILQNTSIGSLAGAAVSGGGEKSKVWSYLFPLLGISSSVVITLRIRKYTTDFTLVQTDDDSADSSQAEKKNQK
KVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G44960 SNARE associated Golgi protein... Lus10006050 0 1
AT5G38260 Protein kinase superfamily pro... Lus10007934 2.4 0.8611
AT2G38050 DWF6, DET2, ATD... DWARF 6, DE-ETIOLATED 2, 3-oxo... Lus10017183 3.5 0.8708
Lus10006401 8.9 0.8899
AT3G52760 Integral membrane Yip1 family ... Lus10017054 9.6 0.8910
AT1G44960 SNARE associated Golgi protein... Lus10028709 13.4 0.8409
AT2G36300 Integral membrane Yip1 family ... Lus10021374 15.0 0.8712
AT4G23610 Late embryogenesis abundant (L... Lus10027179 26.3 0.8621
AT1G32400 TOM2A tobamovirus multiplication 2A ... Lus10011042 30.7 0.8297
AT2G21100 Disease resistance-responsive ... Lus10025063 33.1 0.8523
AT1G71990 ATFT4, ATFUT13,... ARABIDOPSIS FUCOSYLTRANSFERASE... Lus10009440 34.1 0.8352

Lus10006050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.