Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09720 323 / 3e-114 AtRABG3a RAB GTPase homolog G3A (.1.2.3.4) AT1G22740 316 / 2e-111 RAB75, RAB7, AtRABG3b RAB GTPase homolog G3B (.1) AT1G52280 281 / 2e-97 AtRABG3d RAB GTPase homolog G3D (.1) AT3G16100 278 / 3e-96 AtRABG3c, AtRab7D RAB GTPase homolog G3C (.1) AT2G21880 278 / 3e-96 AtRab7A, AtRABG2 ARABIDOPSIS RAB GTPASE HOMOLOG G2, RAB GTPase homolog 7A (.1.2) AT3G18820 276 / 2e-95 RAB71, AtRABG3f, AtRab7B RAB GTPase homolog G3F (.1) AT1G49300 268 / 2e-92 ATRAB7, ATRABG3E ARABIDOPSIS RAB GTPASE HOMOLOG G3E, ARABIDOPSIS RAB GTPASE HOMOLOG 7, RAB GTPase homolog G3E (.1.2) AT5G39620 213 / 1e-70 AtRABG1 RAB GTPase homolog G1 (.1) AT5G47960 111 / 2e-30 SMG1, AtRABA4c SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1) AT3G11730 108 / 1e-29 ATFP8, AtRABD1 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG D1, Ras-related small GTP-binding family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028719 [exp] 386 / 3e-139 AT4G09720 341 / 5e-121 RAB GTPase homolog G3A (.1.2.3.4) Lus10035872 [exp] 281 / 1e-97 AT1G52280 397 / 4e-143 RAB GTPase homolog G3D (.1) Lus10040468 [exp] 276 / 2e-95 AT3G18820 403 / 2e-145 RAB GTPase homolog G3F (.1) Lus10042328 [exp] 270 / 7e-93 AT3G18820 367 / 3e-131 RAB GTPase homolog G3F (.1) Lus10023582 [exp] 263 / 1e-90 AT3G18820 330 / 4e-117 RAB GTPase homolog G3F (.1) Lus10025790 [exp] 156 / 1e-48 AT1G52280 257 / 5e-88 RAB GTPase homolog G3D (.1) Lus10036442 [exp] 111 / 1e-30 AT3G11730 350 / 2e-124 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG D1, Ras-related small GTP-binding family protein (.1) Lus10023829 [exp] 113 / 7e-30 AT3G12160 377 / 5e-132 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Lus10016284 [exp] 109 / 1e-29 AT3G12160 386 / 2e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G062400 [exp] 355 / 1e-126 AT4G09720 375 / 1e-134 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G198800 [exp] 346 / 3e-123 AT4G09720 370 / 2e-132 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G085300 [exp] 292 / 9e-102 AT4G09720 291 / 3e-101 RAB GTPase homolog G3A (.1.2.3.4) Potri.009G115000 [exp] 282 / 6e-98 AT3G18820 408 / 2e-147 RAB GTPase homolog G3F (.1) Potri.004G153400 [exp] 281 / 1e-97 AT3G18820 405 / 2e-146 RAB GTPase homolog G3F (.1) Potri.007G079700 [exp] 261 / 4e-90 AT4G09720 272 / 3e-94 RAB GTPase homolog G3A (.1.2.3.4) Potri.003G053400 [exp] 262 / 6e-90 AT1G52280 395 / 2e-142 RAB GTPase homolog G3D (.1) Potri.001G182900 [exp] 259 / 5e-89 AT3G16100 394 / 7e-142 RAB GTPase homolog G3C (.1) Potri.014G049400 [exp] 115 / 2e-32 AT1G02130 390 / 2e-140 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.002G138400 [exp] 114 / 7e-32 AT1G02130 393 / 1e-141 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10006059 pacid=23147737 polypeptide=Lus10006059 locus=Lus10006059.g ID=Lus10006059.BGIv1.0 annot-version=v1.0 ATGTCAGTCCGCCGCCGTACTTTGCTCAAGGTCATCGTCCTCGGTGACAGCGGCCAGCAGTATAAAGCTACCATCGGTGCGGATTTTGTGACCAAAGAAC TGCAGATTGATGATAAGCTTGCCACTCTTCAAATATGGGACACAGCTGGGCAAGAAAGGTTCCAGAGTCTCGGAGTGGCATTCTATAGAGGGGCAGACTG CTGTGTTCTGGTTTATGATGTCAACAGCATGCGATCGTTTGACAGTCTCGAAAATTGGCATGATGAATTCCTGAAGCAGGCAAACCCAGCAGATCCGAAA TCATTCCCATTCATATTGCTCGGAAACAAGATCGATGTAGATGGTGGAAATAGCAGAGTGGTCTCTGAAAAGAGAGCAAAGGATTGGTGTGCTTCGAAAG GAAACATCCCTTACTTTGAGACTTCGGCGAAAGAGGACTACAACGTCGACCCGGCTTTCCTATGCATCGCCAAAGCTGCTTTGTCCAATGAGCACGAACA AGACATATACTTCCAGAGCATTCCAGACGCGGTCCCAGAAAGCGAACAACGCGGTGGTTGCGCCTGCTGA
AA sequence Show only first row Show all	>Lus10006059 pacid=23147737 polypeptide=Lus10006059 locus=Lus10006059.g ID=Lus10006059.BGIv1.0 annot-version=v1.0 MSVRRRTLLKVIVLGDSGQQYKATIGADFVTKELQIDDKLATLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMRSFDSLENWHDEFLKQANPADPK SFPFILLGNKIDVDGGNSRVVSEKRAKDWCASKGNIPYFETSAKEDYNVDPAFLCIAKAALSNEHEQDIYFQSIPDAVPESEQRGGCAC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G09720		AtRABG3a	RAB GTPase homolog G3A (.1.2.3...		Lus10006059 [exp]	0	1
AT5G66440			unknown protein		Lus10041775 [exp]	2.6	0.9344
AT1G19440		KCS4	3-ketoacyl-CoA synthase 4 (.1)		Lus10042318 [exp]	3.7	0.9223
AT5G50000			Protein kinase superfamily pro...		Lus10042129 [exp]	3.9	0.8805
AT3G22830	HSF	AT-HSFA6B	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10000049 [exp]	4.6	0.9215
AT5G24530		DMR6	DOWNY MILDEW RESISTANT 6, 2-ox...		Lus10024882 [exp]	6.7	0.8888
AT3G12760			unknown protein		Lus10000875 [exp]	10.6	0.8813
AT5G51520			Plant invertase/pectin methyle...		Lus10031712 [exp]	10.8	0.9101
AT1G05010		ACO4, EAT1, EFE	ethylene forming enzyme, ethyl...		Lus10015153 [exp]	12.2	0.8954
AT1G08570		ACHT4	atypical CYS HIS rich thiored...		Lus10015711 [exp]	13.0	0.8815
AT5G06260			TLD-domain containing nucleola...		Lus10021306 [exp]	13.7	0.7971

Compare expression of checked genes

Lus10006059 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.