Lus10006066 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G22710 119 / 4e-33 SUT1, ATSUC2, SUC2 SUCROSE TRANSPORTER 1, ARABIDOPSIS THALIANA SUCROSE-PROTON SYMPORTER 2, sucrose-proton symporter 2 (.1)
AT5G06170 117 / 1e-32 ATSUC9 sucrose-proton symporter 9 (.1)
AT1G71880 116 / 5e-32 ATSUC1, SUC1 ARABIDOPSIS THALIANA SUCROSE-PROTON SYMPORTER 1, sucrose-proton symporter 1 (.1)
AT1G71890 115 / 9e-32 SUC5, ATSUC5 SUCROSE-PROTON SYMPORTER 5, Major facilitator superfamily protein (.1)
AT1G66570 112 / 6e-31 ATSUC7 sucrose-proton symporter 7 (.1.2.3)
AT2G14670 112 / 1e-30 ATSUC8 sucrose-proton symporter 8 (.1)
AT5G43610 112 / 1e-30 ATSUC6 sucrose-proton symporter 6 (.1)
AT1G09960 106 / 2e-28 ATSUC4, SUC4, ATSUT4, SUT4 sucrose transporter 4 (.1)
AT2G02860 71 / 1e-15 ATSUT2, ATSUC3, SUT2 ARABIDOPSIS THALIANA SUCROSE TRANSPORTER 3, sucrose transporter 2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009428 149 / 2e-45 AT1G22710 471 / 1e-164 SUCROSE TRANSPORTER 1, ARABIDOPSIS THALIANA SUCROSE-PROTON SYMPORTER 2, sucrose-proton symporter 2 (.1)
Lus10017910 134 / 2e-38 AT1G71890 693 / 0.0 SUCROSE-PROTON SYMPORTER 5, Major facilitator superfamily protein (.1)
Lus10014821 128 / 6e-37 AT1G71890 532 / 0.0 SUCROSE-PROTON SYMPORTER 5, Major facilitator superfamily protein (.1)
Lus10029766 124 / 1e-34 AT1G22710 655 / 0.0 SUCROSE TRANSPORTER 1, ARABIDOPSIS THALIANA SUCROSE-PROTON SYMPORTER 2, sucrose-proton symporter 2 (.1)
Lus10018915 119 / 4e-33 AT1G71890 616 / 0.0 SUCROSE-PROTON SYMPORTER 5, Major facilitator superfamily protein (.1)
Lus10028616 119 / 4e-33 AT1G71890 617 / 0.0 SUCROSE-PROTON SYMPORTER 5, Major facilitator superfamily protein (.1)
Lus10018914 117 / 3e-32 AT1G71890 593 / 0.0 SUCROSE-PROTON SYMPORTER 5, Major facilitator superfamily protein (.1)
Lus10028614 113 / 1e-30 AT1G71890 603 / 0.0 SUCROSE-PROTON SYMPORTER 5, Major facilitator superfamily protein (.1)
Lus10007702 106 / 2e-28 AT1G22710 588 / 0.0 SUCROSE TRANSPORTER 1, ARABIDOPSIS THALIANA SUCROSE-PROTON SYMPORTER 2, sucrose-proton symporter 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G085800 119 / 4e-33 AT1G22710 645 / 0.0 SUCROSE TRANSPORTER 1, ARABIDOPSIS THALIANA SUCROSE-PROTON SYMPORTER 2, sucrose-proton symporter 2 (.1)
Potri.013G115200 115 / 2e-31 AT1G22710 643 / 0.0 SUCROSE TRANSPORTER 1, ARABIDOPSIS THALIANA SUCROSE-PROTON SYMPORTER 2, sucrose-proton symporter 2 (.1)
Potri.002G106900 103 / 2e-27 AT1G09960 674 / 0.0 sucrose transporter 4 (.1)
Potri.010G093600 64 / 2e-13 AT2G02860 816 / 0.0 ARABIDOPSIS THALIANA SUCROSE TRANSPORTER 3, sucrose transporter 2 (.1.2)
Potri.008G148100 64 / 2e-13 AT2G02860 849 / 0.0 ARABIDOPSIS THALIANA SUCROSE TRANSPORTER 3, sucrose transporter 2 (.1.2)
PFAM info
Representative CDS sequence
>Lus10006066 pacid=23147749 polypeptide=Lus10006066 locus=Lus10006066.g ID=Lus10006066.BGIv1.0 annot-version=v1.0
ATGGACAGGGGATATCCCTTTATGGGGCCGTGTCGAGCCCTGTTAGCGGACTTGTCGGGGAAAAGTTCACGGAAGACGAGGGTGGCGAACGGATTGTTCT
CATTCTTCATGGCCGTCGGGAACATTCTCGGATACGCCGCCGGGTCGTATAGCCATCTCTACAAAATGCTCAAGTTCACCAAAACAGAAGCGTGTGATGT
CTACTGTGCGAATCTGAAGACTTGCTTTATCATCTCCATAACTTTGCTCCTCGTTCTGACCGTTTTAGCCTTGTGCAAATAG
AA sequence
>Lus10006066 pacid=23147749 polypeptide=Lus10006066 locus=Lus10006066.g ID=Lus10006066.BGIv1.0 annot-version=v1.0
MDRGYPFMGPCRALLADLSGKSSRKTRVANGLFSFFMAVGNILGYAAGSYSHLYKMLKFTKTEACDVYCANLKTCFIISITLLLVLTVLALCK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G22710 SUT1, ATSUC2, S... SUCROSE TRANSPORTER 1, ARABIDO... Lus10006066 0 1
AT1G28240 Protein of unknown function (D... Lus10011175 9.4 0.7536
AT1G43650 nodulin MtN21 /EamA-like trans... Lus10028586 12.0 0.6782
AT4G14570 AtAARE, AARE acylamino acid-releasing enzym... Lus10015363 19.4 0.6815
AT4G29230 NAC ANAC075, NST9 NAC domain containing protein ... Lus10012927 24.2 0.7066
AT5G48940 Leucine-rich repeat transmembr... Lus10028612 28.8 0.7049
AT5G47040 LON2 lon protease 2 (.1) Lus10011038 33.6 0.6671
AT1G53310 ATPEPC1, ATPPC1 PEP\(PHOSPHOENOLPYRUVATE\) CAR... Lus10033610 33.7 0.6811
AT2G42320 nucleolar protein gar2-related... Lus10040502 41.4 0.6943
AT4G31080 Protein of unknown function (D... Lus10009547 50.5 0.6834
AT2G28310 Protein of unknown function (D... Lus10021463 51.4 0.5589

Lus10006066 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.