Lus10006079 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009442 52 / 4e-08 AT1G33030 320 / 9e-108 O-methyltransferase family protein (.1)
Lus10014825 47 / 2e-06 AT1G33030 270 / 8e-89 O-methyltransferase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G017210 39 / 0.001 AT5G54160 237 / 5e-77 O-methyltransferase 1 (.1)
PFAM info
Representative CDS sequence
>Lus10006079 pacid=23147744 polypeptide=Lus10006079 locus=Lus10006079.g ID=Lus10006079.BGIv1.0 annot-version=v1.0
ATGGCAAACCGAGATCATGACGAGATGTACGCGATACAGCTCGCGACAGCATCGGTCGTGCCGATGGCTCCAAAGGCCGCGATCGAGCTAGGCCTATTCT
ACTTCTCGTTGAGTTCGATCGCTTGGCGAAACGAGCTGGATTCTCTTGAGCTTGCATCGCCTGTGTCGCCTACAACTTCGCTGTCTTCGAGTTCCTCAAA
CTCGGAACATCATCCATCTAGCTTAAAACACAAGAGCGCTAATGAAACCACTACTCTTGCTGCTAAGGCCATGCTCAGGGCAAAGAAAGGACTCTCGTCG
AGTTCGCTAGCTTGGCTAACCGTGCCGGATTCTCTCGAGCTCGCAACGGCTGTTTCGCCTACAACTTCGCGGTTTTTGAGTTCCTCAAAACATCATCCAT
CTAGCTTTAAAACACAGTTCCAACAGTGTGCCCTTGTATCTAAAGATGTAACTTATTGTCATCATCATGATTCATGA
AA sequence
>Lus10006079 pacid=23147744 polypeptide=Lus10006079 locus=Lus10006079.g ID=Lus10006079.BGIv1.0 annot-version=v1.0
MANRDHDEMYAIQLATASVVPMAPKAAIELGLFYFSLSSIAWRNELDSLELASPVSPTTSLSSSSSNSEHHPSSLKHKSANETTTLAAKAMLRAKKGLSS
SSLAWLTVPDSLELATAVSPTTSRFLSSSKHHPSSFKTQFQQCALVSKDVTYCHHHDS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10006079 0 1
AT1G18720 Protein of unknown function (D... Lus10001647 2.4 1.0000
AT5G12460 Protein of unknown function (D... Lus10003179 2.4 1.0000
Lus10003763 3.0 1.0000
Lus10010414 4.0 1.0000
AT2G22620 Rhamnogalacturonate lyase fami... Lus10010628 4.5 1.0000
Lus10010663 4.9 1.0000
AT4G28780 GDSL-like Lipase/Acylhydrolase... Lus10023578 5.3 1.0000
AT1G15780 unknown protein Lus10023978 5.7 1.0000
Lus10014229 6.6 1.0000
Lus10034359 6.7 1.0000

Lus10006079 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.