Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G72020 141 / 3e-45 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009443 [exp] 187 / 1e-63 AT1G72020 135 / 6e-43 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G081700 [exp] 158 / 3e-52 AT1G72020 134 / 1e-42 unknown protein Potri.013G110600 [exp] 155 / 4e-51 AT1G72020 132 / 9e-42 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006080 pacid=23147724 polypeptide=Lus10006080 locus=Lus10006080.g ID=Lus10006080.BGIv1.0 annot-version=v1.0 ATGGCAATGAACGCCGGTCTCAGATCTGCCTCAAGGCTCGTCGCTGCCTCTGAATCTCTCCTGTCCAAATCAGCAAACAGGGGATTCCACTCAACAGGAG TGAAGAGGATGGGAGGAGGAGGCCACAGTGACTACGAGTACTACCTCCACGCAAAGCACATGTACAACTTGGACAGGATGAAGCACCAGAAAATCAAGAT GCCTCTTGCCGTCTTGACCGCCTTCTCCATCGGCGTCGGAGTTCCCATCTACGCTGTCATCTTCCAGCAGAAGAAGACTTCCTCCGGCTGA
AA sequence Show only first row Show all	>Lus10006080 pacid=23147724 polypeptide=Lus10006080 locus=Lus10006080.g ID=Lus10006080.BGIv1.0 annot-version=v1.0 MAMNAGLRSASRLVAASESLLSKSANRGFHSTGVKRMGGGGHSDYEYYLHAKHMYNLDRMKHQKIKMPLAVLTAFSIGVGVPIYAVIFQQKKTSSG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G72020			unknown protein		Lus10006080 [exp]	0	1
AT5G05610	Alfin	AL1	alfin-like 1 (.1.2)		Lus10009889 [exp]	2.2	0.8091
AT5G05610	Alfin	AL1	alfin-like 1 (.1.2)		Lus10014843 [exp]	5.5	0.7888
AT1G72020			unknown protein		Lus10009443 [exp]	5.7	0.7525
AT4G40042			Microsomal signal peptidase 12...		Lus10006422 [exp]	6.2	0.7978
AT5G42630	GARP	KAN4, KANADI4, ...	KANADI 4, ABERRANT TESTA SHAPE...		Lus10011660 [exp]	13.4	0.7515
AT1G80100		AHP6	histidine phosphotransfer prot...		Lus10011487 [exp]	19.0	0.7407
AT3G13882			Ribosomal protein L34 (.1.2)		Lus10037626 [exp]	27.7	0.7568
AT2G21060		ATCSP4, ATGRP2B	COLD SHOCK DOMAIN PROTEIN 4, g...		Lus10025058 [exp]	29.0	0.7797
AT5G65520			Tetratricopeptide repeat (TPR)...		Lus10025714 [exp]	32.9	0.7371
AT3G49601			unknown protein		Lus10008501 [exp]	35.3	0.7326

Compare expression of checked genes

Lus10006080 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.